CAZyme Information: ASPFODRAFT_47667-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_47667-t33_1-p1
• CAZy Family: GH71
• CAZyme Description: glycoside hydrolase family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	KV878243|CGC5	91990.74	5.0240

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878243:778063-780670(+)

Full Sequence      

MSGKPLTIFTCSSLLFASLIGAQSDTIVLPTRYGTSLGFANYTQHGNASCFTLDQKSSLV
TLDYGTEVGGFPFFHVDSLSTAVQIEAKYTESKTGLDEPFGDGPWTFSNGLSNTFRVETF
NVTSPGMVESFFIQGGLRWQNLKLLTDGSVRICEAGIKSGNDRTPVNKLPGFFESSNSLY
NEIWALGPRTVQQACIAADTAPSTWEVTEEGVFLRGQQPAQSVEGASFGNYTMTFQTKII
RGGTGWKVAAGVGGFGPYFVLTSEYPAGSTFVNINRTIVPANTLAVSYGWNLVNQTSLTT
GKVNHYTLPFNIKEGEWYEISTSINATGYTVTINGTETFVALDGLQIVSGSTGSSGSLTG
GTWGFGPYQDQIALVKDVEVHAQNGTQLYQNSMTLSSVLEEYGVMANKHSVCLDGAKRDR
LVWNGDFVHTYRVIQSSTYRSDFIRETLEYWIDRQAPDSSQYAGYFSMSPAMGQSAKYVD
TYASFGLLDYQLFLLNVFAGHYRNSGDKAFVAKHWTKIKKGVAAILPLIDGQSGLAVATD
VGGFFSGPDNGTAVSGLLAHTLDQMADVASAMNETDVAAMWSHSATLIKAAISQRLWNPR
LEYYATDLSNLTEQSITGTAWAILAGVSNATQAETSLAALSSLRLGIGYKTSSSVANAST
TNLAPFLTGFLLESILQESRNSPNSSQARSTAISVLLDQLWAAMVNQDEYYTGTTWEYLY
PDGRPGLDLYTSHAHPWAAAPTYVLSEYVLGVQATAAGFSEWEFRPAMLDVNVSWARGRV
PTPHGAIQASWRINGTSVQLSVCGPSGTEGTVRVPFNIKSYSVNGEQQIDSKDGLEVHVS
GGSCTDIHAVRS

Enzyme Prediction     

EC	3.2.1.40:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	401	813	2.8e-67	0.746031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	1.97e-10	751	815	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	3.72e-10	387	749	15	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
273702	oligosac_amyl	2.26e-07	420	610	293	471	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS14345.1|GH78	0.0	35	852	50	867
ANZ93894.1|GH78|3.2.1.40	0.0	23	851	59	887
CAK46278.1|GH78	0.0	1	851	1	831
BCS02687.1|GH78	0.0	127	852	1	726
BCR89915.1|GH78	0.0	7	850	7	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	2.13e-09	414	750	237	543	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3CIH_A	1.77e-08	413	787	331	672	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPFODRAFT_47667-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999753	CS pos: 22-23. Pr: 0.9872

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_47667-t33_1-p1.