CAZyme Information: ASPFODRAFT_47579-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_47579-t33_1-p1
• CAZy Family: GH7
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623		67308.03	5.7198

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878243:503107-505027(+)

Full Sequence      

MSSVGLTSSLEDFLAQTYDYLIIGGGTAGLVVASRLSANPDVKVGVIEAGDAGFDDPNIT
NPGKVSAMLHNPKYDWIYQSTPQAQNQNRSHHIPRGKVLGGSSAINFMAYGRPSAVDLDD
WGTIAGNSDWSWAGLAPYYRKSEHLESAGLTGTASELCPVQKEAHGTQGPIHTSLGPWQA
PIETPLLAAMDEVSGLSRPQEPWNGEHLGFHRCLFTIDRSAGLPHRSYAANGYLWPVLSR
PNLHVLTNAVVTRILLDDEQCARGVEFVHEGNMYQVSITREVILSAGTFESPKLLELSGI
GHPEHLASLGVPCRVPLPGVGTNLQEHPVSAVVYELADGVLSIDSILRDESLLKQHLRLL
QEEQSGALSGPVSLMGFIPYGPQVSAERLNETILNVLQHHSNDATDDAELVTFEHRRRQR
IAAHFLDPRSADIQLVGFPSAFAIDRVYADCSKLSPGPPPGRNACYSLMVSSMYPVSRGS
SHAQSRDPEAAPRVDLGFLKNPADVDVLATAVMVADNIFQSPRMKGQVLARVQPPPEVNL
QDVEQAREYVLDRLMSYHHALGTCALGSVVDEKLCVKGTRGLRVVDASIMPAQVSHAVLG
TVYAIAEKAVDLIESAYSQSNGV

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_47579-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	614	8.5e-169	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.81e-107	16	613	4	531	choline dehydrogenase; Validated
225186	BetA	3.81e-95	15	613	5	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	3.10e-32	74	329	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.34e-29	475	609	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.27e-24	7	589	45	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02582.1|AA3_2	0.0	1	623	1	623
BCS14253.1|AA3_2	0.0	1	623	1	623
CAK97143.1|AA3_2	0.0	1	622	1	580
UPX44764.1|AA3_2	3.33e-224	7	620	3	615
ATZ47931.1|AA3_2	4.08e-220	7	614	3	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.80e-66	17	614	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	6.31e-60	18	615	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
5ZU2_A	2.94e-59	18	617	7	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3FIM_B	3.29e-59	18	615	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	4.13e-59	16	617	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	4.76e-219	7	614	3	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	4.76e-219	7	614	3	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	8.99e-209	8	613	4	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	9.14e-85	11	614	33	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	7.18e-81	12	613	41	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994977	0.005045

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_47579-t33_1-p1.