CAZyme Information: ASPFODRAFT_46908-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_46908-t33_1-p1
• CAZy Family: GH63
• CAZyme Description: glycoside hydrolase family 11 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28065.02	4.5978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878242:850041-850889(+)

Full Sequence      

MVSFLGQARLAVPILSAFAWMFAASSAIPPPPPGTLSPERLQWIREVIGNQTEGGSISDL
AKRSTILHTSQDGVDSGGFYYSVYNDNGASVGYTEYPTTGQFELGWNTETEFLGGKGFKG
GSTRSLTWDGYFTAEGDWTLAIYGWTLNPVTEWYIVESHGTGTPGNGNILGQVNSDGGVY
DVYNLPYRNVPEIYGVTNFDQHWSVRRSHRSTGTVDVSTHFQRWKELGLNPGTPVFQMVT
LEGFSGQGYLDFTVQA

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_46908-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	78	251	3.2e-49	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	9.30e-59	77	251	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02029.1|GH11	1.21e-191	1	256	1	256
BCS13717.1|GH11	1.21e-191	1	256	1	256
ALN49265.1|GH11	2.59e-177	1	256	1	256
CAG17889.1|GH11	2.04e-174	1	256	1	256
CAK97322.1|GH11	2.04e-174	1	256	1	256

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VGD_A	2.30e-47	61	254	21	214	Crystal structure of environmental isolated GH11 in complex with xylobiose and feruloyl-arabino-xylotriose [Escherichia coli]
2VUJ_A	2.37e-47	61	254	21	214	Environmentally isolated GH11 xylanase [Escherichia coli]
5JRM_A	4.51e-47	76	254	14	192	Crystal Structure of a Xylanase at 1.56 Angstroem resolution [Fusarium oxysporum],5JRN_A Crystal Structure of a Xylanase in Complex with a Monosaccharide at 2.84 Angstroem resolution [Fusarium oxysporum f. sp. vasinfectum 25433]
3WP3_A	9.37e-47	59	254	13	206	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
4XQW_A	1.55e-46	76	254	9	188	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CFS3|XYNA_ASPTN	1.53e-50	56	254	36	230	Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xlnA PE=3 SV=1
sp|P48824|XYNB_ASPKW	8.12e-49	56	255	30	225	Endo-1,4-beta-xylanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=xlnB PE=3 SV=2
sp|B0XXF3|XYNA_ASPFC	2.50e-48	76	254	49	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xlnA PE=3 SV=1
sp|Q4WG11|XYNA_ASPFU	2.50e-48	76	254	49	227	Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnA PE=1 SV=1
sp|P55330|XYNB_ASPNG	3.24e-48	60	255	24	225	Endo-1,4-beta-xylanase B OS=Aspergillus niger OX=5061 GN=xlnB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.442598	0.557389	CS pos: 27-28. Pr: 0.4255

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_46908-t33_1-p1.