CAZyme Information: ASPFODRAFT_46011-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_46011-t33_1-p1
• CAZy Family: GH55
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537		58993.44	6.9415

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878241:842217-843830(-)

Full Sequence      

MKGILYTRASTLGGCTAHNALVAIYPHRSDWTYIANLTNDPSWLPDPMREYYIRLENNHY
LPPDIPGHGYTGWLSTEHAPINLVLQDPQLLSLLLGAVFTQPRTILSNLISLLLGDVNSP
SPSRDSKPAYYQTPIATSSNVRNGAADFLRAVLSATNPDGTQKYPLTIRTNCHVTRVLFD
TTSHPPKATGVSFLDGPYLYRASPLSSPHTPRTPGTATATREVILSAGVFNTPQILQLSG
IGPADLLQKHNIPVLVNLPGVGANLQDHYETSVVVEAPFPFRILNGCTFNYTSDPCLIRW
LNPKGLHKDRGIYSSAGFTSTLLHHTPFPNTSTTPNHNKDNNNDDYNTIIYGGLVNFRGY
FPGFEVNITRTHHSFTWAIIQAHPSNRAGTVNISSSDPLDPPHILFNSFSDPDSEKDLFA
LVDVIRVARRALKRQLIPTWETLPGKEVRGYEELRQYVLDTSWGHHAVGSCRIGRGEGDD
DDDEGAVVDGKFRVRGVRGLRVVDASVFPRAQGTFPVLGVYMLAEKAVGDILGDDGG

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_46011-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	532	5e-81	0.8661971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.32e-54	6	536	81	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.85e-54	140	533	193	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.54e-29	389	527	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.10e-25	142	523	220	568	Protein HOTHEAD
366272	GMC_oxred_N	5.83e-15	140	270	124	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15218.1|AA3	0.0	1	537	122	658
BCS03593.1|AA3	0.0	1	537	122	636
QMW33146.1|AA3	2.90e-198	1	534	122	644
QRD84722.1|AA3	2.90e-198	1	534	122	644
QMW45179.1|AA3	2.90e-198	1	534	122	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	1.13e-36	6	526	87	521	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.13e-36	6	526	87	521	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	2.85e-36	6	526	87	521	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6YS2_AAA	1.36e-25	166	533	214	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.43e-25	166	533	214	562	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.47e-35	6	526	87	521	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|B1JSR0|BETA_YERPY	1.34e-33	8	533	81	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|A7FKL6|BETA_YERP3	1.34e-33	8	533	81	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	2.47e-33	8	533	81	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	2.47e-33	8	533	81	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_46011-t33_1-p1.