CAZyme Information: ASPFODRAFT_44952-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_44952-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	KV878240|CGC9	49465.26	6.9949

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878240:760000-761415(-)

Full Sequence      

MLTAARQPGLNNRDQNYAAGRLLGGTSAINGLAFVPPALAGIDAWEALGNPGWSWQSLAP
YFYRSFHVCPEAAPGNGPGAAASAATGPIEVTYPALAEPRNHTIIDAWNKTFADKGYAFS
DTLIPTPTTGTRPYTATITTTGVRSASTQYAASRPNLRILTNTMVERILFDTTSTTVTAT
GVLLHNDPSPITATKEVILAAGAFNTPKLLELSGIGSASRLSKHNIPCIIDNPSVGENLN
NHLMAVLPVPIQPLPDTASPTPGIQAISFVRSGAEADLLSRHLPHPPLNNLLANPSEPTA
CFFLSTLPNSMAILGLIPSYPLSRGSVHLSSSQPTDKPIIDPSYLSHPLDIKLMAAHFKT
LHSLPACSPFSGILGSAPGPSPETQDPGVVEETLRASVVAAHHFCGTAIMAPREKGGVVD
TELRVHGTGNLRVVDASVFPTVTAANPMSTVYAVAERAAEIIRGRDRPACA

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_44952-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	463	1.9e-117	0.8855633802816901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.38e-76	1	469	65	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.76e-66	7	466	72	535	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.80e-42	321	458	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.16e-23	11	243	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.74e-20	141	465	217	580	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS00980.1|AA3_2	0.0	1	471	1	471
BCS12736.1|AA3_2	0.0	7	471	73	537
CAK96464.1|AA3_2	3.93e-291	7	465	70	529
QRD83786.1|AA3_2	5.33e-114	2	463	63	530
QMW32332.1|AA3_2	5.33e-114	2	463	63	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.25e-49	13	463	76	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	3.99e-41	2	467	63	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	7.30e-41	3	463	63	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.33e-40	3	463	64	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	5.21e-39	8	462	103	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	1.85e-49	7	464	114	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.85e-49	7	464	114	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A5C1RDA6|ASC9_DIDFA	9.23e-48	7	462	79	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A1U8QYA8|CICC_EMENI	2.12e-47	11	462	112	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	9.88e-46	3	463	107	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.531005	0.468979

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_44952-t33_1-p1.