CAZyme Information: ASPFODRAFT_43459-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_43459-t33_1-p1
• CAZy Family: GT71
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	KV878238|CGC12	46416.91	7.8374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878238:3446120-3447531(+)

Full Sequence      

MAPTRLRRLAIVALIGAVLMICICQQRTKFDTKPIDLEDQYPLLYRHVHTHNTEGGAWYI
PPKWTSASKPPPKNIVEAAELALSAARASPDGYLPHSTIPMIVHQTWKNTRIDTWPHIIR
HSAERWLQTAEGEMAYFLWTDEGMEQFIHHFEPDLESHYAHLARNVERSDVFRIVISKWI
GGVYGDIDTEPLRKPADWITPTDLHAWNDTRAGTSYNSTAPVRAIVGLEADCPEGSDTYW
RMGYSQPVQLTQWAFAWAPGHPILQTFIDRLSATIGDISNRYGGSLQSRAARQELMNLDP
LTLTGPAAFTDVVRSRLEEVAGLRWHALSGLKDGGKSKLVDDVLILPITGFSPGRGKYGN
MGSKPITDPSARLRHLAQGSWRAFDVRVEYGKFCRTVLGMCRDWSKVPTVAVQ

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_43459-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.33e-18	93	373	76	338	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.45e-06	136	199	20	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93027.1|GT32	0.0	1	413	1	413
BCS05686.1|GT32	0.0	1	413	1	413
CAK38082.1|GT32	2.18e-305	1	413	1	413
ADK37855.1|GT32	9.03e-220	1	386	1	385
QKX57092.1|GT32	7.30e-172	5	406	10	414

PDB Hits     

ASPFODRAFT_43459-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.75e-25	159	382	202	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	7.15e-24	68	382	96	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	9.37e-16	93	382	90	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	5.01e-15	93	352	124	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UT67|IMT2_SCHPO	5.83e-06	99	203	82	188	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.503799	0.496203

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_43459-t33_1-p1.