CAZyme Information: ASPFODRAFT_42230-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_42230-t33_1-p1
• CAZy Family: GH43
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	KV878238|CGC2	38270.38	4.6125

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878238:643247-644302(+)

Full Sequence      

MHGNLHLPQNITAVQNIVSDGSSTWFTLEGPKVDWTGPEDVNNGWIDSYGQPWWDANPAG
SSGIDNRPHLMSFKTSQATIKYFRSRKPIAWNVKLHGQDITVSHAIIDATSTGSFPFNTD
GFDVEGTNIQITDSIMYNGDDAIAVGADSHDILFTRNTIGYQTHGMSIGSLGKDPTDFAN
ISNIRFDDVTVVDGLYAARFKSWSGGTGLVKNVTWNNIRVFNVTFPIYVTQSYSDQGASR
SGTVNASSAVMMEDFTWSDFSGSINTYQPGDGSCVSDPCWYNVGLPNLKHTEALIIECHT
SQSCKNFVTDNIQLYPQVLEPASVICLNATAALNPDLGFTCKNGTYSPIST

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	15	331	6.7e-48	0.8215384615384616

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	6.52e-30	19	307	41	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	5.89e-22	8	328	118	388	polygalacturonase
215426	PLN02793	1.90e-20	100	344	211	428	Probable polygalacturonase
177865	PLN02218	6.58e-20	35	263	149	381	polygalacturonase ADPG
178580	PLN03003	3.60e-18	8	279	82	347	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06604.1|GH28	3.73e-269	1	351	90	440
BCR93993.1|GH28	3.73e-269	1	351	90	440
ABD14402.1|GH28	3.27e-263	1	350	90	439
ABD61565.1|GH28|3.2.1.67	4.64e-263	1	350	90	439
CAK44512.1|GH28|3.2.1.67	3.11e-240	1	350	72	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CZF_A	1.80e-16	11	307	66	356	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]
1HG8_A	5.47e-16	46	274	81	321	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1K5C_A	3.34e-14	26	235	61	264	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27UB0|PGXC_ASPNG	8.25e-264	1	350	90	439	Exopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgxC PE=2 SV=1
sp|A2QEW2|PGXC_ASPNC	8.25e-264	1	350	90	439	Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxC PE=3 SV=2
sp|Q2UQ40|PGXC_ASPOR	4.19e-217	1	347	90	435	Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxC PE=3 SV=1
sp|B8MZZ6|PGXC_ASPFN	4.19e-217	1	347	90	435	Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxC PE=3 SV=1
sp|A1D7I1|PGXC_NEOFI	3.64e-214	3	348	94	439	Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000005

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_42230-t33_1-p1.