CAZyme Information: ASPFODRAFT_38862-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_38862-t33_1-p1
• CAZy Family: GH31
• CAZyme Description: carbohydrate esterase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	KV878236|CGC10	38064.45	4.3814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878236:661553-662780(-)

Full Sequence      

MFVKWQFLALAAVPMIPAYPSGAAHKEDFDWDSTKYLIAFGDSYTYVQGTDGLQNYSFIG
DLQHFAYDPHTLLTDKIVQNQTATAEGGPNWVEYLTGCGLDEGLTSPSDCDLQLWDFAFA
GSDISVEYTPLHHNFTVSLVNQVKQFTTYAQPVLQNTIDPSHALIAIWIGINDIGDSSKY
DVDFPTFYNDLMTTLFSSVQSIYSQGYRSYLFMNLPPLDRRPGNLGSADPSPNATQITWY
NDALAQRASAFGARYADTNVMLFDAHSELSYILDHPAQFGIVNITNFCAGYDQPDIAWDY
RKYGCPTPLDTYFWFNSGHMTSHVHEILAGKVRRFLLGE

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_38862-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	37	332	3.4e-90	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	9.90e-62	36	335	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	2.53e-18	117	332	80	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	6.69e-11	37	329	32	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	1.42e-04	75	267	6	191	GDSL-like Lipase/Acylhydrolase.
238883	Triacylglycerol_lipase_like	6.21e-04	163	329	104	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS08972.1|CE0	2.70e-257	1	339	1	339
BCR96460.1|CE0	2.70e-257	1	339	1	339
CAK37535.1|CE0	6.16e-192	1	336	14	314
QRD91661.1|CE0	2.22e-168	18	329	18	328
UDD64353.1|CE0	2.22e-168	18	329	18	328

PDB Hits     

ASPFODRAFT_38862-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2FKR1|AES1_THETO	2.22e-22	6	332	3	293	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|G2QJ27|AES1_MYCTT	1.10e-21	6	332	3	293	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999727	CS pos: 23-24. Pr: 0.6024

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_38862-t33_1-p1.