CAZyme Information: ASPFODRAFT_33477-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_33477-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: glycoside hydrolase family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797	KV878242|CGC4	87650.17	5.2210

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878242:852124-854583(-)

Full Sequence      

MRLAYYNLVFFGFIFASGDCSTSYRPTTYFNASQNNWIEYHNDTVLKLSSDGVTPAIIIL
DYGRDVEGYATFQVSSMSGDTSGFEMAYSETYALLGSAMADGPLSFDATMDTYRVNRYNV
TEERTYTNRLIQGGLRYQKLNLSSAGEMHLSLVGFKPTVSNIPLADLPGSFNCSDDVLTR
IWHAGARTSQLTEFPANSIPDFWVLTDEGALIDSLAPQPYYTIWSPSLTTYDLEFSVKPI
SKGFSFNVLSDTLSNGIYIFVDIANASISAHAGSTELDPIIASGHLSPSIILNEWHKVQS
NVNMSQISVQIDNTTVLDFSQTASFYGSFGVGASFGHSAIFTNLSLLVGGEQKYFSTLKD
ESALSDFLVGTNPLPVSVDGSRRDRLAYAGDLDMASSTSFASTNGIDYINGSIELLGSYQ
MTPGFFVPNAKVQQPPRTTDVEANTTGLIGYSFNLVSAMAKFYEQTGDEVFLHRWAPKVM
RMLDWAHSQTLPNNLLNITDPALGGGWDIYDPASSGIVSQFNMLYAYSLNKWIRYLEQAN
INVTVYQRRLENLQEAINYHLWSDKLQAYYHSKTYQNFFSQDANALAILSDTTKLTGNRT
NTVLSTMAQQLYIPKGALSFSNASMASGFAQKISPYASGYHLKAAFHANDGVNAKKLLHS
VWGPISDPKNANYTGCMWEVINPDGTPGIWSGTSLCHAWSAGPTADLSRYVLGIQPVTPG
FKEWRVAPQTLGLDWARGEYPTPHGNIRVDWSFDGSGRFNIVANAPVGTKGTVVLPSPLN
GTLEVQGGKVYRWEQHT

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_33477-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	373	775	3.7e-68	0.7341269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	4.94e-17	713	792	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	0.002	463	602	111	264	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13718.1|GH78	0.0	77	669	1	593
BCS02030.1|GH78	0.0	77	669	1	593
UDD63660.1|GH78	0.0	12	783	231	1001
QMW46762.1|GH78	0.0	12	783	18	788
QMW34696.1|GH78	0.0	12	783	18	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.43e-15	378	749	331	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPFODRAFT_33477-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000650	0.999319	CS pos: 20-21. Pr: 0.6422

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_33477-t33_1-p1.