CAZyme Information: ASPFODRAFT_30842-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_30842-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: glycoside hydrolase family 29 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791		87947.91	5.0093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878238:3228836-3231321(-)

Full Sequence      

MKVVNQIALAWQLAVTAAAASQSKFVSLESYFNNKAFGVYPGQTSFDALNQSYPDPSIIG
INGTYTSTHTGVVYNFPGYRGPVLPDNVVCEGQTIIVPREKYFSASMLVTSDVQLFTVSG
NVTYTYSDNSTLVSELRSLPWWAFLTINRGEIIFPYRYTHNDTNFNTSHIFEYTAALDPN
KTLHSITLPVTTNTTTGRLHIFSISLWESTAPSAQVQFVRPTQKWTESGNQIVEVTINNP
GISCIAGTGVNISLSMPGVQTLEPGNIKRLCPGDQKRVNIGINGTANGTATVVLNYTHSI
QHQTYPHTLSLGLTEWTSELSSLSQHESPEWFDDAKFGIMIHWGPYSVPGWGNSTPYESY
AEWFWWYTTHRAADKSDTYDYRLRTFGPDWNYDDSFPSFTASNFSPKAWVDLIAASGAKY
FVLTTKHHDGFALFDTQNTTTRSSLHYGPRRDLVSELFTASSLHHPSLKRGTYFSLPEWF
NPDFGPYGFAELPGNTSTSWPGIIARNPYTGLNEPYTGRIPVTDFITDVMVPQMTILAHN
YSTDIMWCDCGAANGTASFASEWFNSARADNRQVTINSRCGVAEVSDFDTPEYATFSSAQ
LRKWESNMGMDPYSYGFNRATGRQGYMNASTVVRDLVDMVSKNGNFLLDVGPRADGSIVE
REERELRRAGEWIRGHGEAVFGTRVWWVRSEGVGVRVGSGDGGQVEVEVRFTQTNEAFYL
LFLGEPGNKVFVDAPVPLLEGDRVVVVRGEGAGEREVEWEGSAAEGFTFTVPEGAWNGEE
FCWVLKAVYVA

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_30842-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	315	682	4.9e-89	0.9219653179190751

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214829	Alpha_L_fucos	2.39e-94	322	735	13	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
395889	Alpha_L_fucos	6.16e-86	315	678	7	333	Alpha-L-fucosidase.
226195	AfuC	3.37e-37	342	734	1	363	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93111.1|GH29	0.0	1	791	1	789
BCS05767.1|GH29	0.0	1	791	1	789
QKX54848.1|GH29	0.0	7	791	11	797
CAK41610.1|GH29	0.0	256	791	1	531
QDS68271.1|GH29	0.0	19	791	28	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ODU_A	3.77e-61	322	788	14	447	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
2ZWY_A	4.37e-61	322	788	14	447	alpha-L-fucosidase [Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]
1HL8_A	7.21e-61	322	788	14	447	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
2WSP_A	3.63e-60	322	788	14	447	Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8],2WSP_B Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8]
7LJJ_A	1.21e-47	308	732	34	456	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17164|FUCO_RAT	3.52e-59	316	790	33	461	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
sp|Q2KIM0|FUCO_BOVIN	5.34e-58	316	691	40	383	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1
sp|Q60HF8|FUCO_MACFA	5.34e-58	313	786	36	463	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
sp|P04066|FUCO_HUMAN	1.84e-57	316	786	37	461	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
sp|Q99LJ1|FUCO_MOUSE	6.60e-57	309	790	16	451	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000456	0.999507	CS pos: 20-21. Pr: 0.6804

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_30842-t33_1-p1.