CAZyme Information: ASPFODRAFT_30570-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_30570-t33_1-p1
• CAZy Family: GH27
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	KV878238|CGC3	38063.45	4.0269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878238:2321976-2323198(+)

Full Sequence      

MHSYQLLGLAAVGSLVSAAPAPSRVSEFAKKASTCTFTSASEASESISSCSDVVLSGIEV
PAGETLDLSDAADGSTITFEGTTSFGYKEWKGPLIRFGGKDLTVTMAEGAVIDGDGSRWW
DSKGTNGGKTKPKFMYIHDVEDSTFKGINVKNTPVQAISVQATNVHLNDFTIDNSDGDDN
GGHNTDGFDISESTGVYISGATVKNQDDCIAINSGESISFTGGTCSGGHGLSIGSVGGRD
DNTVKNVTISDSTVSDSANGVRIKTIYKETGDVSEITYSNIQLSGITKYGIVIEQDYENG
SPTGTPSTGIPITDVTVDGITGTLEDDATQVYILCGDGSCSDWTWSGVDLSGGKASDDCE
NVPSGASC

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	48	368	2e-75	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	3.45e-149	52	368	3	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	4.95e-28	112	367	149	394	polygalacturonase
177865	PLN02218	2.18e-27	87	361	143	417	polygalacturonase ADPG
215426	PLN02793	2.02e-23	104	339	145	382	Probable polygalacturonase
215120	PLN02188	5.92e-23	76	362	97	390	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06061.1|GH28	1.03e-262	1	368	1	368
BCR93418.1|GH28	1.03e-262	1	368	1	368
CAA41693.1|GH28|3.2.1.15	4.70e-259	1	368	1	368
CAK44054.1|GH28|3.2.1.15	4.70e-259	1	368	1	368
ACS44814.1|GH28	1.85e-242	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NHC_A	6.14e-239	33	368	1	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	1.02e-160	30	368	6	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	5.85e-160	30	368	6	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	1.03e-158	35	368	3	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
2IQ7_A	1.05e-149	35	366	3	335	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26213|PGLR1_ASPNG	8.35e-260	1	368	1	368	Endopolygalacturonase I OS=Aspergillus niger OX=5061 GN=pgaI PE=1 SV=1
sp|A2QAH3|PGLR1_ASPNC	8.35e-260	1	368	1	368	Probable endopolygalacturonase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaI PE=3 SV=1
sp|A1CVV8|PGLRA_NEOFI	1.89e-217	1	368	1	368	Probable endopolygalacturonase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgaA PE=3 SV=1
sp|Q4WQT2|PGLRA_ASPFU	8.95e-216	1	368	1	368	Probable endopolygalacturonase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pgaA PE=3 SV=1
sp|B0Y4Z4|PGLRA_ASPFC	8.95e-216	1	368	1	368	Probable endopolygalacturonase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000272	0.999709	CS pos: 18-19. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_30570-t33_1-p1.