CAZyme Information: ASPFODRAFT_296759-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_296759-t33_1-p1
• CAZy Family: GH27
• CAZyme Description: glycoside hydrolase family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676		74003.97	4.6451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878245:1166747-1168879(-)

Full Sequence      

MRCHRLLSGVLALLPLSVAQSCWRNTTCSGPTDSAFSGPWEKNIFAPSSRTLNPEKLFLI
TQPDKTEDYTPFALHGNGSLVVYDFGKEVGGIVSVNFSSTGTGALGVTFTEAKNYIGEWS
DSSNGGFKGPDGALYGNFTEAGSHYYVMPDKSLRGGFRYLTLFLITSDNSTIHIEDVSLE
IGFQPTWSNLKAYQGYFHSNDDLLNKIWYTGAYTLQTNEVPTDTGRQIPAMAEGWANNCT
LGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDLDSVKNALQVMYDTQNNSTGAFDE
SGPPLSQKDSDTYHMWTMVGTYNYMLYTNDSDFLEQNWEGYQKAMDYIYGKVTYPSGLLN
VTGTRDWARWQQGYNNSEAQMILYHTLNTGAELATWAGDSGDLSSTWTSRAEKLRQAINE
YCWDESYGAFKDNATDTTLHPQDANSMALLFGVVDADRAASISERLTDNWTPIGAVAPEL
PENISPFISSFEIQGHLIVGQPQRALELIRRSWGWYYNNANGTQSTVIEGYLQNGTFGYR
GNRGYYYDTAYVSHSHGWSSGPTSALTNYIVGITVTSPLGATWRIAPQFVDLQSAEGGFT
TSLGKFQAGWSKTDTGYTLDFTVPHGTQGNLTLPFVGTAKPSIKIDGTEITRGVQYANAT
ATVTVSGGGTYKVVVQ

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	80	633	1.2e-98	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	6.75e-15	195	468	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.65e-06	577	648	3	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225922	SGA1	3.44e-05	238	463	267	502	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
273702	oligosac_amyl	3.06e-04	307	484	351	525	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
225990	COG3459	0.001	314	459	671	847	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43282.1|GH78	0.0	1	664	1	624
UCK57529.1|GH78	0.0	6	676	12	686
QRD88907.1|GH78	0.0	6	676	12	686
QMW37218.1|GH78	0.0	6	676	9	674
QMW25160.1|GH78	0.0	6	676	9	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.97e-19	157	604	273	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPFODRAFT_296759-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.016176	0.983800	CS pos: 19-20. Pr: 0.9158

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_296759-t33_1-p1.