CAZyme Information: ASPFODRAFT_210711-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_210711-t33_1-p1
• CAZy Family: GH17
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		65776.70	6.0652

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878247:1069386-1071287(+)

Full Sequence      

MAMVSNGNEYDFIVVGGGTAGNAVAGRLAENPNVRVLVVEAGIPNPDQVDEITTPSKAFN
LRGSKYDWAYKTTMIKRDDYERVEKPNTRGKALGGSSCANYFTWIPGSKPTFDDWEAFGG
HDWTWDNCVEYLRKCATYHDDEKLYPAELSKIGTGGPVQIAHADLVPEMQPFRDALTQAW
VSKGEKLTEDIYSGEMRGLTHCVDTIYNGQRQGSFLYLKDKPNVTILYGAHSKQLIIDPV
TRVCSGVTVVSEAYNTEISVYASREVILSQGVFETPKLLMLSGIGPAAELAKHNITPIVE
SPHVGQHLLDHPIVPFVLRLKDGYGLEDHILRPGPTNNAAIAQYKKDKTGPISSGLLELV
GFPRIDQRLEKYPAYREAKAANGGLDPFGPAGQPHFELDFVGMFSTAFQWHYPIPEEGNH
MTVIVDLLRPLSEGEVTLNNSNPLVQPNINLNFFGNDLDILAMREGVRWTYDLLTSGAGF
KDIVLSEYPWKMPLQSDDEMKRAVLDRSQTGFHPCGTARLSKSIHQGVVDSKLRVHGVRN
LRIADASIIPVIPDCRIQNSVYMIGEKGADIIKADHKDLYESKNIPYFVPSRL

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_210711-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	575	1.7e-150	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.91e-90	7	577	5	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.68e-87	8	589	4	546	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.19e-41	430	567	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.97e-22	89	313	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.61e-22	8	565	54	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS00597.1|AA3_2	0.0	1	593	1	593
QKX58151.1|AA3_2	0.0	1	593	1	593
BCS26129.1|AA3_2	0.0	1	593	1	593
UNI24682.1|AA3_2	0.0	1	593	1	593
QLI65786.1|AA3_2	0.0	1	593	1	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	3.73e-309	5	580	2	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.07e-308	5	580	2	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.05e-308	5	580	2	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.94e-74	9	575	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.06e-73	9	575	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A9AMZ9|BETA_BURM1	1.83e-59	9	589	5	547	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|A0A3B1EFP9|STR4_STRTC	1.19e-57	9	573	35	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	1.76e-56	9	572	2	525	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	3.37e-56	9	589	5	547	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q8G1Z8|BETA_BRUSU	3.37e-56	9	572	2	525	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999979	0.000073

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_210711-t33_1-p1.