CAZyme Information: ASPFODRAFT_205740-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_205740-t33_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	KV878239|CGC3	67021.76	5.6061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878239:1969100-1971005(+)

Full Sequence      

MKRDTSSLSDIPPVYDYVVVGGGTSGLVVASRLTEDPAVSVLVLEAGSDRVDDPRIAAPA
LAASTYFDPEFDWSLISEPQEGLNGRRLAQSRGRTLGGSSAINMGMAIYPSRSDIDSWEQ
LGNTGWNWKSLSTYMRKSQTFIPPSDEIRDQLSLGYVDPDVQGTNGPIHISFGDGPFPAF
TAAWPRTFEALNHRLTGDPMSGLAKGAFCNPATIHGTSRARSHAGVAYYTPEIAQRSNLR
VITEAFVEKVLLDKTACVNDGQAIATGIQFRGNDGIQRTVAARAEVILAAGTIKTPHLLE
LSGIGDAKLLQAHGIDIIIDNPNVGENLQEHGLVPFTWEAADGQITGEALRDPEVAKAAM
EAWQSSGAGPLGSHPLGSAFMTLPELENGELSGLIEKHLKEEGSARQTAQYRILRRFLED
HDEPTCQYTLAPFQMTPDKGSDPRGTFSMSEPGNYISIVAVLNRPFSRGSVHLASSDPTV
LPTFDPRMLSHPLDLEIQARHVMWLETLAATEPMASLLKPNGRRLHYPTRVTSLETAREL
TRDRLLCHYHVSGTAAMMPREIGGVVDDRLRVYGCRNLRVVDASVIPLIPRGNIQTTVYA
VAEKAADIIKEDKLASL

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_205740-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	612	1.2e-177	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.42e-96	9	616	2	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.74e-91	15	610	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.44e-37	465	605	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.28e-28	84	331	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.36e-23	3	598	44	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13057.1|AA3_2	0.0	1	617	2	618
BCS01313.1|AA3_2	0.0	1	617	2	618
CAK40027.1|AA3_2	0.0	1	617	1	617
QGA17771.1|AA3_2	6.02e-308	4	613	5	612
BCS27275.1|AA3_2	1.15e-217	15	612	17	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.73e-80	15	613	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.05e-79	15	613	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	4.53e-79	15	612	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	7.50e-69	15	612	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	2.10e-65	2	612	26	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	3.50e-98	15	612	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.50e-98	15	612	14	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.70e-88	16	612	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	4.43e-81	15	609	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.43e-81	15	609	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_205740-t33_1-p1.