CAZyme Information: ASPFODRAFT_204747-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_204747-t33_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	KV878238|CGC12	30363.18	4.0945

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878238:2571739-2572635(-)

Full Sequence      

MKQAGSILALAGLVSLAQGHGFVTSPQARMPGSAMEKACGQQVYNNQEADNYGNVQGELQ
IASGQSDYDADACDIWLCKGYKYADNKDNVYSYKAGETVDFTVDIRAPHTGTANVSVVDT
ASNTVIGSPLIYWSVYASTSTGVTANETSFSVTIPDDLGDKCTEGGACVLQWWWNAASID
QTYESCIDFTVGGSGSSSSSSSSSSSSSAAASQQTTTTAAAAAVTTPSTANNVAPASSSV
PTTLATSVKQSATVAPVAASSAAAAASSSGVSIPTDGTAEEQLTWVASLLKALLKYAN

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_204747-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	20	189	3.2e-74	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	2.63e-07	20	189	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05968.1|AA16	3.42e-148	1	298	1	299
BCR93324.1|AA16	3.42e-148	1	298	1	299
CAK37296.1|AA16	6.10e-146	1	298	1	297
BCR86587.1|AA16	4.48e-106	1	296	1	268
UDD64172.1|AA16	1.02e-105	1	296	1	282

PDB Hits     

ASPFODRAFT_204747-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPFODRAFT_204747-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000318	0.999633	CS pos: 19-20. Pr: 0.9762

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_204747-t33_1-p1.