CAZyme Information: ASPFODRAFT_203300-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_203300-t33_1-p1
• CAZy Family: GT8
• CAZyme Description: carbohydrate-binding module family 50 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		25350.58	4.0362

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878237:1754263-1755046(+)

Full Sequence      

MLPGPNKLFLLTAALFGHAMALPATVDYDVLPSTGSVLNLDVAASNITYTVQGNDTIHTI
AAKYNVGACDLARLNVLSDPNFLYENETLRIPARATFPDDYSCFSMNNTDATATCIYGGP
HVYTILPGDTIQKIANERYNITTDSILSFTAQTGYIAALNPGIYDVLETGQTVKIPSCDN
SACTMADFTFTYGTLQDFATAYNVSVGQIMSLNLGYNHTDYIAPLGVVYDCTLLD

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_203300-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	1.27e-08	32	222	388	585	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	3.69e-08	47	91	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	1.49e-07	48	91	1	44	Lysin motif.
396179	LysM	2.94e-07	49	92	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
180536	PRK06347	2.39e-06	33	213	317	508	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS04533.1|CBM50	5.28e-171	1	235	1	235
BCS16114.1|CBM50	5.28e-171	1	235	1	235
CAK48349.1|CBM50	4.62e-160	1	235	116	350
BCR95504.1|CBM50	1.42e-112	14	235	8	228
BCS08044.1|CBM50	1.42e-112	14	235	8	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	2.43e-29	6	217	2	204	Chain A, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P403|CIH1_COLLN	4.09e-17	48	178	109	230	Intracellular hyphae protein 1 OS=Colletotrichum lindemuthianum OX=290576 GN=CIH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999685	CS pos: 21-22. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_203300-t33_1-p1.