CAZyme Information: ASPFODRAFT_202611-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_202611-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: glycoside hydrolase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		66736.48	5.0493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878236:3900052-3901836(+)

Full Sequence      

MLKPQQTPFRDIVSLDGLWKFALGSSGNETAAPWTAPLATNLECPVPASYNDIFVDRQIH
DHVGWVYYQREAIVPSGWSHQQYLVRVEAATHHGRIYINDHLVAEHVGGYTPFEADITDL
VSAGNSFRLTIAVSNVLTHETIPPGRIEVEEYTGKITQVYQHDFFNYAGLSRSVSLYSVP
KQHIQDIRVVTNVDGTTGLIDYLVTVSNSTTERIKINVVDEDGRTVTEASGTRGTATIDS
ARLWHPGDAYLYQFQVSIVGSDDSIVDTYSVATGVRTVKVSGNQFLINDKPFYFTGFGKH
EDSNVRGKGYDPAYMVHDFQLMNWMGANSFRTSHYPYAEEVMEFADRHGIVVIDETPAVG
LSYSIGAGQSSEDSQQTFTPEGINNKTREAHKQAIRELIARDKNHASVFMWSIANEPASH
EAGAREYFAPLVDLTHELDSTRPVCFTNYGDATYELDRISDMFDVLCLNRYFGWYTQTGE
IEEAEAALEKELLGWEGKYDKPIVMTEYGADTIAGLHSVLGLPWSEEFQVELVDMYHRVF
DRVESVVGEQVWNFADFQAAVGVSRVDGNKKGIFTRDRKPKAAARALRKRWRPM

Enzyme Prediction     

EC	3.2.1.31:89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	593	1.2e-100	0.6170212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	0.0	1	594	1	595	beta-D-glucuronidase; Provisional
225789	LacZ	1.39e-107	1	592	1	596	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	2.64e-97	278	593	1	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	3.30e-37	68	556	113	547	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	5.43e-26	12	180	1	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95379.1|GH2	0.0	1	592	1	592
BCS07927.1|GH2	0.0	1	592	1	592
CAK36851.1|GH2	0.0	1	591	1	591
AEP39213.1|GH2|3.2.1.31	0.0	1	591	1	591
BCR84878.1|GH2	0.0	2	594	41	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C71_A	0.0	1	591	34	622	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
5C70_A	0.0	1	591	9	597	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
6LEJ_B	1.93e-224	1	594	1	591	Chain B, Beta-D-glucuronidase [Escherichia coli]
6LEG_A	2.00e-224	1	594	2	592	Chain A, Beta-D-glucuronidase [Escherichia coli],6LEG_B Chain B, Beta-D-glucuronidase [Escherichia coli],6LEG_C Chain C, Beta-D-glucuronidase [Escherichia coli],6LEG_D Chain D, Beta-D-glucuronidase [Escherichia coli],6LEL_A Chain A, Beta-D-glucuronidase [Escherichia coli],6LEL_B Chain B, Beta-D-glucuronidase [Escherichia coli]
3K46_A	2.07e-224	1	594	3	593	Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K46_B Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K4D_A Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],3K4D_B Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],6LEM_A Chain A, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P05804|BGLR_ECOLI	9.91e-224	1	594	1	591	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|O97524|BGLR_FELCA	5.04e-168	1	591	27	625	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|P12265|BGLR_MOUSE	3.67e-167	1	592	27	624	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2
sp|P06760|BGLR_RAT	1.04e-166	1	592	27	624	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
sp|O18835|BGLR_CANLF	1.14e-166	1	591	27	625	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000010

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_202611-t33_1-p1.