CAZyme Information: ASPFODRAFT_193868-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_193868-t33_1-p1
• CAZy Family: GH106
• CAZyme Description: glycosyltransferase family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609		70458.87	6.2102

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878245:1088133-1090017(-)

Full Sequence      

MRTQRFVVWLGTFVLVSLFLIFFRGPSPSPSPIVDLYPSSDSRPPTTLQRPPVPSNAQLI
EQSGLRKAAHPDSLHPIASLVNNAEQQFDRLLSRQSKTLAQAVNEYRERYNMHPPPHFDK
WFQFAKDRGVQLIDEYDTIYHALLPFWALEPKTIRDRARETLGFDNSMIGVLIRNGSVSL
VEGGAFEQSWQRSATAKMIGSFVEYLPDMDLVFNALDEPRVVVPSEDLQRLVAIAREQVS
QITVTNTMPTNAWSDRPSDLNKGDRIDEVRTTRFNRFTRQSTWSYSRSSCPVDSPVRSLD
EQAADNVNSYAQGELGFIYNTSAFSDICNSPSLRHKYGFFDRPNRFEAVHDLFPVFSQSK
ISSYQDILYPSPWYWSDQVPYEEDKDMEWNEKSSQMFWRGSTTGGYSRAGGWRRQHRQLF
VGNVNALNTAKILSKTESNQWKARGVGRNSFANLFDVRFTYIGQCDDKDCAAQGEYFDLA
EPVDQQDAWAYKHLLDMDGNAFSGRFYAFLRSRSLVHKVSIFREWHDEWLKPWTHYVPLS
LTGDDYLEAMRYFESEEEGRVIAPRLAQQGREWAQKALRNEDMEVWFFRLLLEYGRLVDD
NRHNLGFSV

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_193868-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	331	598	1.4e-82	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.53e-23	332	597	10	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.18e-10	354	597	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10289.1|GT90	0.0	1	609	1	609
BCR97835.1|GT90	0.0	1	609	1	609
CAK43248.1|GT90	0.0	1	609	1	609
UCK57446.1|GT90	1.97e-301	1	609	11	619
BAE54850.1|GT90	1.12e-300	1	609	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	6.96e-10	354	598	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	4.19e-09	341	601	105	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	5.03e-55	75	604	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	3.71e-10	354	598	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	8.72e-10	346	598	156	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	3.70e-09	354	598	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.50e-08	341	601	133	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000017

TMHMM  Annotations     

Start	End
7	26