CAZyme Information: ASPFODRAFT_193328-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_193328-t33_1-p1
• CAZy Family: GT76
• CAZyme Description: glycosyltransferase family 4 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672		75593.20	6.2642

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878245:374739-376974(+)

Full Sequence      

MSSISSDFDAESWSGRPLNVIYAGITELISDNSSGRVAIAIRNLTDLVDFLVCTWHAPRP
NVSDYATDTIITELKRYREKHAEKIVSAALHQSLVYRCPSLCSRLWSELDIVPLVLDHKD
RERQHNDQGELTTFAGWHKKELDERADSMVRNSFGIGHVLHNRINFDGSVDVDRGYHVHL
ASAEDYEKTVDPVTWSLAQCFAQDLREREVKVAFFSMTCQGKPDVPTRHALSRFTESVGV
HVKWFVPKPRPRMIPLIRKMQDTLEGLGDPLSDITINDELLILDFAYSNARRYWLCETGP
LRPRVEGGVDVVIIDSAPLLTLALLSKQQDPERPVIFESSLQPQGESLNDPNSPQSRAWD
FIRTRLTHVDLVVSLLPKELAPRIMPEENVGYMSFSVDQLDGQNKSLTDWDIGYYGREFS
SLCRTLQMTIIRYPEGKIPKPGPLAILNSHALEQYILHLSQFRPGDGTLCLLHAYQKFCD
IYAKEHPSRQVPKLLICHRGPFRTPESTVFYDAAMSQIDSSETLSASVCIVPIGAVDQMW
NALLTNARALVQLSTLHGIPELLLAAIQRGTPVVAVREAELFPFVHESENAILVDKGEEE
EIAQCILRIFSVDRVSRGKAGAGFRRLSDANTTVGNAVGWLYLVSKLSKGVKFKPRGRDI
FGLAREETECSY

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_193328-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	2.42e-85	211	647	1	378	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
223515	RfaB	3.69e-05	455	628	201	358	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340838	GT4_MtfB-like	0.001	439	628	177	349	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
340828	GT4_WlbH-like	0.004	480	608	220	338	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
340831	GT4_PimA-like	0.008	542	609	263	330	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10530.1|GT4	0.0	1	672	1	675
BCR98080.1|GT4	0.0	1	672	1	658
CAK47237.1|GT4	0.0	1	672	1	661
QMW47856.1|GT4	1.54e-205	9	664	16	659
QMW35794.1|GT4	1.54e-205	9	664	16	659

PDB Hits     

ASPFODRAFT_193328-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6YRN9|TREPH_PLEPU	2.91e-83	18	672	40	723	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|O75003|TREPH_GRIFR	9.87e-80	18	672	36	716	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|Q9UV63|TREPH_PLESA	1.43e-78	18	672	40	735	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_193328-t33_1-p1.