CAZyme Information: ASPFODRAFT_183968-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_183968-t33_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	KV878238|CGC19	52315.90	7.0097

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878238:3629840-3631275(+)

Full Sequence      

MGRRMKLSAFHIVTLALAAVLGISIWSLWLGVNSDRDNIHPLLNQLIPAGHCACHTAAIF
ECDSCLRCPAQLPFHDTASSSSAPPTETFFDPLEYSYNETQCTTLFPGLFEDLIRAQSFW
TARHGIKRTDIDNIKMVDGMAKVAIYQGRLYVLRSLAKGEDHRRKILGILASIHRALVSA
PQLAVILNTEIIFSVEDKLEDVAGPDHPLWVLARKATEESVWLMPDFGFWSWGHIDTQIG
PYDEVVKHVEEHELPWDEKENKLVWRGKLSFAPKLRRALLEIARNYAWGDVKEVEWKNKA
NYLSMDNHCDYRFIAHVEGRSYSASLKYRQACRSVVVIHKLQYIQHHHYLLVSSGPQQNF
VQVERDWTDLPHKIQELLDNPIKARMIADNNVEVFRERYLTPAADACYWRALLQGWTTAS
PQVTETMSDPTNVSNKGIRYESFLMLDPSNMMRFRP

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_183968-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	190	417	1.6e-18	0.956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	2.42e-18	223	414	122	317	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	7.59e-17	223	416	46	249	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW35140.1|GT0	2.80e-309	1	454	1	453
QRD91520.1|GT0	2.80e-309	1	454	1	453
QMW31874.1|GT0	1.88e-207	20	454	22	454
QRD90937.1|GT0	1.88e-207	20	454	22	454
UDD60835.1|GT0	7.61e-207	20	454	22	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	3.64e-06	177	414	125	373	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	6.58e-08	208	414	162	383	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	8.40e-07	211	414	164	382	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	1.95e-06	211	414	164	380	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999276	0.000729

TMHMM  Annotations     

Start	End
7	29