CAZyme Information: ASPFODRAFT_172206-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_172206-t33_1-p1
• CAZy Family: CE16
• CAZyme Description: glycoside hydrolase family 47 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1095		121427.92	5.6042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878250:90931-94404(-)

Full Sequence      

MRSGCWHSQMSALRSAWILTWVLQLSLWLSMAQGMRTDQVKELRKETEHMFYHGFDNYLE
HAFPEDELRPLTCRPLVRDRDNPAHAELNDVLGNYSLTLIDSLSSLAILSSSPDQGQKAW
DYFQNGVKDFVALYGDGSNGPAGQGQRGRGFDMDSKVQVFETVIRGLGGLLSAHLFAVGD
LPISGYNPPEAEANFARAWDKHSFPEGSHGIEWEDGFVYDGQLLRLAVDLANRILPAFYT
DTGLPYPRVNLKYGVQRQPYYANSPFNAAPTCDKANPEQCQKPRRSSTFETTETCSAGAG
SLVLEFTVLSRLTGDGRYEELAKRAFWAVWARRSDIGLIGSGIDAESGRWVHSYTGIGAG
IDSFFEYAFKSYVLLSSGERPPVNTSSPWHVLDDYFLPLSEYEHSADAFLKVWEESHASI
KRHLYRGEGHQHPHLIQGDIFTGATRAFWIDSLSAFYPGLLTLAGEVDEAIGIHLLTTAV
WTRFSGLPERWNVATGDIEQGLSWYGGRPEFVESTYYLYRATKDPWYLHVGEMVLRDLKR
RCWTKCGWAGIQDVRNGELNDRMESFFLGETAKYMFLLYDFDHPLNKLDQPFVFSTEGHP
LIIPKNSTAQRAERKQVPVDVESEGLTCPTAPEPPTLGVSSTAARSDLFHAANLARLHLM
PSRGVAEGPLLDYARDHPSVSVSDLSSPTNYTFFPWTLPPELVPFNATSAPMTIRPTLDI
SFPALPGMVVGPGSLERVRDGIFIKAIGGLRLSMVQDVPVLGETGSAEGDEFRVQVINNV
PLGKDEKVYLLREITFDVLDPTDPNFTRVRDTAMVDIVIDVIPESIRRRNDSDDSHEPAA
PRRANGAIVHGSSAVDSKVGSVDASTSSMKTVLSSLVNTLSTLLRDEVHGQTSLPQKKKP
TSLRLLLPAAISTGLGSAPLPDVEDATTVSITGDPSKQRLTWNSIYFADELCDDRILREV
AQNHQVLVIKRGGCSFSQKLRNIAAYPPSRYALKLVIVVSYDDEVEEQQHDGSDTTTTTT
PGLAAVRAEPYLVRPHLDETQMTAAGVPRRQLLSVVMVGGGQETYELLRQATGVGIKRRY
SVRSQGVPINNLYIL

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_172206-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	50	602	1.9e-144	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	6.32e-134	50	603	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.77e-58	36	605	65	520	glycoside hydrolase family 47 protein; Provisional
239038	PA_C_RZF_like	0.007	952	1005	53	104	PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like. This group includes various PA domain-containing proteins similar to C-RZF (chicken embryo RING zinc finger) protein. These proteins contain a C3H2C3 RING finger. C-RZF is expressed in embryo cells and is restricted mainly to brain and heart, it is localized to both the nucleus and endosomes. Additional C3H2C3 RING finger proteins belonging to this group, include Arabidopsis ReMembR-H2 protein and mouse sperizin. ReMembR-H2 is likely to be an integral membrane protein, and to traffic through the endosomal pathway. Sperizin is expressed in haploid germ cells and localized in the cytoplasm, it may participate in spermatogenesis. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05200.1|GH47	0.0	1	1095	1	1096
BCS16758.1|GH47	0.0	1	1095	1	1096
ABF69939.1|GH47	0.0	44	1095	34	1083
CAK40963.1|GH47	0.0	19	1095	1	965
QMW34129.1|GH47	0.0	1	1095	1	1090

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	2.01e-30	50	603	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.19e-30	50	603	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.25e-30	50	603	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	5.81e-30	50	603	95	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	9.17e-30	50	603	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	1.38e-118	30	614	22	488	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	6.49e-110	42	605	124	583	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	1.44e-109	42	599	129	582	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|P38888|MNL1_YEAST	1.26e-101	32	676	24	572	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9FG93|MNS4_ARATH	3.80e-90	31	610	28	481	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000279	0.999712	CS pos: 34-35. Pr: 0.8288

TMHMM  Annotations     

Start	End
13	35