CAZyme Information: ASPFODRAFT_172071-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_172071-t33_1-p1
• CAZy Family: CE16
• CAZyme Description: glycoside hydrolase family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	KV878249|CGC1	89589.49	5.5259

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878249:921132-923507(-)

Full Sequence      

MASPDWTRAAPWIWLPHYLEEDNRPGRFFLFRKTFQWHPSDDLQDLPVHVSADSRYRLFV
NGHRVSWGPCKSYPGKWYYETVDIHPYLRDGKNVISARVLRYSTLVPGSSSIVSMPLPGF
MLYSPHPELAISTDPSWMCIEQRSVKIVPQTEWNYLLGPPFLSNNERAEEDQTITGWQMP
GYDDATWDKAAFQSNAVKMLPIVSPWKLAPRPIPDLPEIEGRFDGIVKATGSVSEDEWKL
LVREDKPVVIPANAQVTVDLSVEALMTAFVSFGFSGGGGAKISILYSECYEKDLGVETAP
FPMPRSKSNRSDASGRLYGVKDFYTVTSGQDVHSFESFWFRCFRYVQLGITTTANPITLT
SISLRETSYPLEITTKVDAGAELNKIWEISLRTLQNCRHETYEDCPFYEQNQFASDSRLQ
MLFTYQLSPDDRLARKTLEEFHASRTPDGLIVAQYPTGFASKQIPQFSLFWILMVHDHMM
YFADRTLVRRYLSTVDSIIQHFEDRLDDRGLVGHFDPDTWPFVDWVQDWFVPGQIFKSCM
PPAYHTAGAATVNSLMYAYALLHAAELCEFVGRISTAEEYRARAHSIRSAVNQRCTSNSQ
LYLDGPGVEQYSQHTQVFAILSETVTGDAAKQLLRQTVTDSSLAQCSYAMKFYVFRAAEK
TGIYSELFPSMLDPWRSMMANNLTTWAEDEVNARSDCHGWSASPVNEIVTQLFGVKPAEP
GFERVRIEPRRELVAAADGLLHTSRGNIKVQWAPGKPLSVEVTSKIPVEIVVDGRVVERV
LGPGEPVTFAE

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	264	769	1.2e-101	0.9563492063492064
CBM67	10	195	5.9e-35	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	7.10e-18	383	706	13	334	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	6.32e-08	48	190	8	150	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15768.1|GH78	0.0	1	791	1	791
BCS04174.1|GH78	0.0	1	791	1	791
CAK49119.1|GH78	0.0	1	790	1	790
QDS72372.1|CBM67|GH78	0.0	1	781	1	783
BCS25990.1|GH78	8.85e-254	6	758	5	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	9.16e-34	247	770	430	939	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	3.27e-12	342	704	172	534	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

ASPFODRAFT_172071-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_172071-t33_1-p1.