CAZyme Information: ASPFODRAFT_168323-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_168323-t33_1-p1
• CAZy Family: CE12
• CAZyme Description: carbohydrate esterase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		24426.49	4.6966

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878246:232640-233514(-)

Full Sequence      

MYKNIVTAALLSSALASASTAHANGKAPCAKVHMMLARGTTESYPGLLGSLTDLVMDAIP
DSDYENIIYPATQEGSTPSYEEGIYNGTAQLKAYVKACPETKVVLFGYSQGAMVVSDMLA
GGGDNGTLGNITAPAVDPETGSHIAAVLLYGDPRHMPNQTYNVGDVSATGKYPRTPEQLA
ALSKYADRLHDYCDDKDGVCDAAGTNLSAHMAYATIWDKVAATWVESMMQK

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_168323-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	28	227	1.1e-43	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	7.04e-26	28	225	1	169	Cutinase.
369775	PE-PPE	0.001	60	134	1	92	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10743.1|CE5	1.40e-164	1	231	1	231
BCR98400.1|CE5	1.40e-164	1	231	1	231
CAL00335.1|CE5	1.85e-144	1	231	1	231
UQC76608.1|CE5	5.27e-81	29	229	35	239
ATZ52428.1|CE5	2.10e-69	10	230	11	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	2.82e-23	29	229	2	206	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	1.66e-20	29	229	2	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.66e-20	29	229	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	1.66e-20	29	229	2	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
4PSC_A	3.03e-12	28	222	78	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2J8C362|CUTI1_VERDA	1.00e-25	7	229	3	229	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	4.46e-22	26	229	30	237	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	2.77e-20	1	229	1	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|P9WP42|CULP1_MYCTO	2.74e-12	5	213	14	196	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1
sp|P63880|CULP1_MYCBO	2.74e-12	5	213	14	196	Carboxylesterase Culp1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2006C PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999740	CS pos: 23-24. Pr: 0.9664

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_168323-t33_1-p1.