CAZyme Information: ASPFODRAFT_153025-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_153025-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: glycoside hydrolase family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
993	KV878237|CGC17	110003.15	5.4998

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878237:952141-955734(-)

Full Sequence      

MRLPVLLKLVVALATLCQALSVSNNSSGTVTWDGYSLIVNGERVFVNAAEFHYQRLPVPE
MWLDVLQKLKANGFNTISVYFFWSYHSASREAYDFESGAHNIQRLFDMAKETGLWVIARP
GPYVNAQTNAGGLALWGSDGSMGKLRTSDEAYHEAWLPYMRRVGQIIAANQITKGGPVIL
FQVENELRETRHEPNNTLVTYMEQLESVIREVGITVPTTHNEQSTRYISWSRNYENVGGA
VDIYGFDDYPAGFLVGNKCDGATGFDVVRTYYQWFMNYAWSGPIYLAEFEGGRTLTWGAP
QNYDDCRSEHSTTFVDIYYKNNIGQRVTLQSIYEGYGGTNWGHSACPVAYTSNDYMTPLR
ETREQWAKLWQTKLIQLFSGSAPDLLKTNMHGNGSGYSLSTPDAYSWVLKNPDTQATFTV
LQQNETSSTATITFSAYLNTSLGNVTVPGIQLEGRQSKILVTDYKFGNQTLLYSSADVLT
NAVLPGHDVLTLYLWEGQTGEFALRTSKNLTFEVYGASTVLSTLHHGYQKIKYTQSTGST
VLRFSNGVIVLLLDQPTAWHFWAPSTSKYPSPRSDQKLFILGPYLVRSASVNNEVLQLSG
DNNGTTTLEGFIGNVPIKAIEWNGQLLTATKTPYGSYTAQIPGTENRSVTLPPLNHWHSA
ESLPEIQPDFDDSRWTVANKNSTLSPQAPLTLPVLFSSDYGYYAGAKIYRGYFDDIEYTA
VNITASGGLAFGWNAWLNGHLIGGDPGDPDLSATNLTLTLPASHLKTGNNVITVLVDYHG
HDETDIPNGAENPRGILGAYLLPGGTRTATGFKLWRIQGNAGGSKNIDPVRGPMNEGGLY
AERLGWFLPGFPAPDDKEFKSTSSPLDGISGSGVRFYVTTFDLDIDSDLDAPIGISLSAP
NGTIARVMLWVNGYQYGKYVPHIGPQTKFPIPPGIINNRGQNTLALSVWAQTDAGAKLDT
VELFTYGLYQTDFQFDRDWSYLQPRWKDRSMYS

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	37	375	2.9e-73	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.16e-65	36	363	1	302	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	2.93e-65	385	560	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	3.87e-41	384	561	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	4.38e-38	840	954	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
166698	PLN03059	5.79e-27	27	420	27	389	beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR94715.1|GH35	0.0	1	993	1	993
CAK48192.1|GH35	0.0	1	993	32	1009
BCS07304.1|GH35	0.0	108	993	1	886
UQC78589.1|GH35	0.0	19	993	18	982
QSZ31820.1|GH35	0.0	13	986	7	975

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	1.35e-170	30	963	6	943	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	5.22e-167	30	963	46	979	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.44e-166	30	963	46	979	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	6.89e-160	30	963	46	977	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	9.59e-154	30	963	26	975	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7EZS5|BGALC_SCLS1	0.0	15	988	9	978	Probable beta-galactosidase C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacC PE=3 SV=1
sp|B6QHA9|BGALC_TALMQ	0.0	23	993	23	999	Probable beta-galactosidase C OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) OX=441960 GN=lacC PE=3 SV=1
sp|B6H5X9|BGALC_PENRW	0.0	1	988	1	976	Probable beta-galactosidase C OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacC PE=3 SV=1
sp|A2QL84|BGALC_ASPNC	0.0	18	988	16	988	Probable beta-galactosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacC PE=3 SV=1
sp|A1CE56|BGALC_ASPCL	0.0	30	988	32	979	Probable beta-galactosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999755	CS pos: 19-20. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_153025-t33_1-p1.