CAZyme Information: ASPFODRAFT_145506-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_145506-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446		47015.92	3.8137

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878250:270939-272442(-)

Full Sequence      

MPALSILALALAPLLVNGQLSGSVGPLTSAHSKAATKTCNILDYGAVADNSTDIGSPLSE
AWDACSDGGLIYIPPGDYAMDTWVSLSGGKATAIILDGTIYRTGTDGGNMILVENSSDFE
LYSNSSSGAVQGFGYVYHREGDLDGPRILRLQDVSNFAVHDIILVDAPAFHFVMDDCSDG
EVYNMAIRGGNSGGLDGIDVWGSNIWVHDVEVTNKDECVTVKSPANNILVESIYCNWSGG
CAMGSLGADTDITDILYRNVYTWSSNQMYMIKSNGGSGTVKNTLLENFIGHGNAYSLDID
SYWSSMTAVDGDGVELSNITFKNWKGTEADGAERGPIKVVCSDTAPCTDITIEDFAMWTE
SGDEQTYTCESAYGDGFCLEDSDSTTSYTTTQTVTTAPSGYSATTMAADLTTDFGTTASI
PIPTIPTSFYPGVTAISPLASAATTA

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	78	372	6e-51	0.916923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	7.81e-19	146	370	85	313	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	2.11e-18	29	372	27	390	polygalacturonase/glycoside hydrolase family protein
215540	PLN03010	3.34e-18	40	375	48	392	polygalacturonase
165802	PLN02155	2.29e-16	32	374	21	380	polygalacturonase
215426	PLN02793	3.95e-16	19	374	36	411	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIN75624.1|GH28	0.0	1	446	1	446
CAK41025.1|GH28	0.0	1	446	1	446
CAA63911.1|GH28|3.2.1.171	0.0	1	446	1	446
AAB35485.1|GH28|3.2.1.171	1.55e-256	1	440	1	439
CAB58937.1|GH28|3.2.1.171	1.55e-256	1	440	1	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	1.44e-253	19	440	1	421	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	5.75e-18	26	362	9	365	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P87160|RHGA_ASPNG	0.0	1	446	1	446	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|A2QYE5|RHGA_ASPNC	0.0	1	446	1	446	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|Q00001|RHGA_ASPAC	2.75e-257	1	440	1	439	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|Q5ARE6|RHGA_EMENI	5.90e-252	7	442	6	441	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2R3G4|RHGB_ASPNC	3.31e-240	4	446	6	451	Probable rhamnogalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999714	CS pos: 18-19. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_145506-t33_1-p1.