CAZyme Information: ASPFODRAFT_144247-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_144247-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
957	KV878248|CGC5	108855.07	5.6552

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878248:344083-347074(-)

Full Sequence      

MSNRWTLLLSLVILLGCLVIPGVTVKHENFKTCSQSGFCKRNRAFADDASAQGPSWTSPY
ELDSSSIQFKDGQLHGTILKSVSANEKVKLPLVVSFLESGAARVVVDEEKRLNGDIQLRH
DSKARKERYNEAEKWVLVGGLELSKTATLKPETETGFTRVLYGPDNQFEAVIRHAPFSAD
FKRDGQTHVQLNNKGYLNMEHWRPKVEVEGEGEQQTQEDESTWWDESFGGNTDTKPRGPE
SVGLDITFPGYKHVFGIPEHADSLSLKETRGGEGNHEEPYRMYNADVFEYELNSPMTLYG
AIPFMQAHRKDSTVGVFWLNAAETWVDIVKSTSSPNPLALGVGATTDTQSHWFSESGQLD
VFVFLGPTPQEISKTYGELTGYTQLPQHFAIAYHQCRWNYITDEDVKEVDRNFDKYQIPY
DVIWLDIEYTDDRKYFTWDPLTFPDPISMEEQLDESERKLVVIIDPHIKNQDKYSISQEM
TSKDLATKNKDGEIYDGWCWPGSSHWIDTFNPAAIKWWISLFKFDKFKGTLSNVFIWNDM
NEPSVFNGPETTMPKDNLHHGNWEHRDIHNVHGITLVNATYDALLERKKGEVRRPFILTR
SYYAGAQRMSAMWTGDNQATWEHLAASIPMVLNNGIAGFPFAGADVGGFFHNPSKELLTR
WYQAGIWYPFFRAHAHIDTRRREPYLIAEPHRSIISQAIRLRYQLLPAWYTAFHEASVNG
MPIVRPQYYAHPWDEAGFAIDDQLYLGSTGLLAKPVVSEEATTADIYLADDEKYYDYFDY
TVYQGAGKRHTVPAPMETVPLLMQGGHVIPRKDRPRRSSALMRWDPYTLVVVLDKNGQAD
GSLYVDDGETFDYERGAYIHRRFRFQESALVSEDVGTKGPKTAEYLKTMANVRVERVVVV
DPPKEWQGKTSVTVIEDGASAASTAPMQYHSQSDGKAAYAVVKNPNVGIGKTWRIEF

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	362	809	3.9e-146	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	0.0	115	885	19	744	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269889	GH31_GANC_GANAB_alpha	0.0	381	850	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	362	809	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269890	GH31_glucosidase_II_MalA	3.55e-141	381	720	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	9.01e-110	281	887	92	669	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98911.1|GH31	0.0	1	957	7	963
BCS11223.1|GH31	0.0	1	957	7	963
CAK40395.1|GH31	0.0	1	957	1	957
CAS97680.1|GH31	0.0	1	957	1	957
ACF60497.1|GH31	0.0	1	957	1	957

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	0.0	25	957	5	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	0.0	25	957	5	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
7KRY_A	1.38e-251	12	956	21	941	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]
5IEF_A	3.20e-250	25	956	1	910	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	3.30e-250	25	956	1	910	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	1.12e-293	26	897	28	881	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	2.24e-249	19	956	25	942	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|Q4R4N7|GANAB_MACFA	1.01e-247	9	956	18	942	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
sp|P79403|GANAB_PIG	1.01e-247	13	956	18	942	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q14697|GANAB_HUMAN	2.27e-246	19	956	25	942	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000440	0.999528	CS pos: 24-25. Pr: 0.9548

TMHMM  Annotations     

Start	End
7	25