CAZyme Information: ASPFODRAFT_142568-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_142568-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: carbohydrate esterase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	KV878247|CGC1	35714.10	4.0312

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878247:1197797-1199118(+)

Full Sequence      

MVKSILASVLFAATALAASRMTAPSGAIVVAKSGGDYDTISAAVDALSTTSTETQTIFIE
EGSYDEQVYIPALSGKLIVYGQTEDTTTYTSNLVNITHAIALADVDNDDETATLRNYAEG
SAIYNLNIANTCGQACHQALAVSAYASEQGYYACQFTGYQDTLLAETGYQVYAGTYIEGA
VDFIFGQHARAWFHECDIRVLEGPSSASITANGRSSESDDSYYVIHKSTVAAADGNDVSS
GTYYLGRPWSQYARVCFQKTSMTDVINHLGWTEWSTSTPNTENVTFVEYGNTGTGAKGPR
ANFSSELTEPITISWLLGSDWEDWVDTSYIN

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	307	1.7e-78	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	3.01e-49	28	296	2	266	Pectinesterase.
178051	PLN02432	6.28e-43	28	321	13	291	putative pectinesterase
178346	PLN02745	3.96e-40	16	297	275	552	Putative pectinesterase/pectinesterase inhibitor
215179	PLN02314	7.18e-40	24	321	276	574	pectinesterase
178106	PLN02488	4.78e-39	28	330	199	503	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12403.1|CE8	1.16e-238	1	331	1	331
BCS00638.1|CE8	4.14e-238	1	331	35	365
CAA02202.1|CE8|3.1.1.11	4.73e-238	1	331	1	331
CAA02198.1|CE8|3.1.1.11	4.73e-238	1	331	1	331
AKA88527.1|CE8	4.73e-238	1	331	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	1.05e-68	19	329	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.49e-68	19	329	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	1.11e-32	28	321	10	307	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.69e-27	29	331	6	313	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.19e-12	34	296	45	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	8.40e-239	1	331	1	331	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.26e-171	1	329	1	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A2QK82|PMEA_ASPNC	6.22e-68	19	329	30	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	8.05e-68	19	329	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	8.05e-68	19	329	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000371	0.999598	CS pos: 17-18. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_142568-t33_1-p1.