CAZyme Information: ASPFODRAFT_141527-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_141527-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		36020.47	6.6896

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878246:48372-49337(+)

Full Sequence      

MAVFFGRPRQLGVAVIFSVIIFVIFQFIYTDDFALTGHLTESIQIVDACSPDALEDVHNS
RPPLDPVIPNIVHQLWKTTDISEYSTTITASCESWKTMLEPFNYTVKLWTDDDVLELIKA
DYTWMLSTYEGYPHDIQRADIARLLIVHSEGGIYSDLDVNPKSAERIRCLQGLRFQAIFS
PTAGTLGLSNHFFMARPGSPFLEWVLHEAKRRSSRLASRGILLPYLQVFWSTGPIMVTAA
FRQYAWLYNTPRLDIGLLNDGFIGLVVQHAAGRSWQGVDGRVLNYIADQAGLGLIFGAVA
CFSAVAGLILIAKRYNTRVPR

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_141527-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	162	1.8e-16	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.82e-23	63	244	77	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.36e-09	93	161	9	79	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98326.1|GT32	1.46e-236	1	321	1	321
BCS10670.1|GT32	1.87e-209	1	321	1	291
CAK45844.1|GT32	3.85e-135	26	261	27	263
UNI15388.1|GT32	1.06e-119	31	314	13	302
CAP80286.1|GT32	6.24e-113	1	293	54	348

PDB Hits     

ASPFODRAFT_141527-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	9.15e-29	33	303	34	289	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	1.06e-23	46	297	31	277	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.99e-23	54	321	41	300	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.26e-23	39	318	54	322	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	2.36e-22	46	297	31	285	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000016

TMHMM  Annotations     

Start	End
10	29
220	242
290	312