CAZyme Information: ASPFODRAFT_137952-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_137952-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	KV878243|CGC3	47575.52	5.7906

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878243:1730042-1731310(+)

Full Sequence      

MPRRRLILVAALLALGLLYTLTSHGASSPPLQIIPNDCPSRPDLDNILVVLKTGVTESRT
KVPIHLSTTLRCIPNHVLFSDYVEQLSPTHFTHDVLASLSPALLNHNPELDLYRRVRAEG
PAALTAADLNPDVNTPIGKPNNPGWKLDKWKFLPMLDEALRVKPDANWYIFLEADTYLVW
DNFLQWLRRFDPSKPWYLGNQMQIVDAIFAHGGSGFALSRPALVQAVNQRKRTSDGWERA
VAEHWAGDCMLGILLENVGVDLTWSWPMLQIAPPEEMDYFSIGYAKRPWCYPAVSFHHLD
EQGIRQLDDLERELGPLKTPLLYRDVFLKLVRPELRDVRTEWDNLVDGDPVAVSSFAACR
GVCTREAKCLQYAYNETEGACRTSTVLALGHARPGLSAGWMTERIDAMAESLGECREISW
ID

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_137952-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	9.55e-07	168	286	87	226	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.006	164	221	209	272	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS14707.1|GT31	0.0	1	422	1	422
BCS03059.1|GT31	0.0	1	422	1	422
CAL00916.1|GT31	0.0	1	422	1	422
QMW28702.1|GT31	8.62e-152	2	421	11	437
QRD83231.1|GT31	8.62e-152	2	421	11	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	3.32e-06	133	341	72	300	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9JJ05|C1GLT_RAT	3.78e-09	165	350	161	363	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1
sp|Q9NS00|C1GLT_HUMAN	3.78e-09	165	350	161	363	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q0VC84|C1GLT_BOVIN	3.86e-09	165	351	161	363	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q9JJ06|C1GLT_MOUSE	5.04e-09	165	350	161	363	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
sp|Q7SYI5|C1GTB_DANRE	1.23e-07	130	300	126	311	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B OS=Danio rerio OX=7955 GN=c1galt1b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.111722	0.888254	CS pos: 25-26. Pr: 0.8488

TMHMM  Annotations     

Start	End
7	26