CAZyme Information: ASPFODRAFT_136710-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_136710-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	KV878243|CGC8	47296.31	4.3423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878243:1149616-1151294(-)

Full Sequence      

MRLTHVLSHTLGLLALGATAEAFSRSREAACGPKKPFRPLPTSQSRDKTCHVRSHGDGTD
DSDYILSALNQCNHGGKVVFDEDKEYIIGTALNMTFLKNIDLEVLGTILFTNDTDYWQAN
SFKQGFQNATTFFQLGGEDVNMYGGGTINGNGQVWYDLYAEDDLILRPILMGIIGLNGGT
IGPLKLRYSPQYYHFVANSSNVLFDGIDISGYSKSDNEAKNTDGWDTYRSNNIVIQNSVI
NNGDDCVSFKPNSTNILVQNLHCNGSHGISVGSLGQYKDEVDIVENVYVYNISMFNASDM
ARIKVWPGTPSALSADLQGGGGSGSVKNITYDTALIDNVDWAIEITQCYGQKNTTLCNEY
PSSLTISDVHIKNFRGTTSGSEDPYVGTIVCSSPDTCSDIYTSNINVTSPDGTNDFVCDN
VDESLLSVNCTATSD

Enzyme Prediction     

EC	3.2.1.67:7	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	70	424	9.2e-73	0.9692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.06e-39	139	421	54	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	3.78e-28	190	421	176	390	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	4.31e-28	100	414	111	401	Probable polygalacturonase
215540	PLN03010	3.93e-26	54	422	54	390	polygalacturonase
178580	PLN03003	6.15e-26	138	409	113	359	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02851.1|GH28	0.0	1	435	1	435
CAA68128.1|GH28|3.2.1.67	0.0	1	435	1	435
BCS14503.1|GH28	0.0	1	435	1	435
ABD61562.1|GH28	0.0	1	435	1	435
CAK46374.1|GH28	0.0	1	435	1	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.92e-71	33	432	2	384	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	2.60e-22	89	399	35	313	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1HG8_A	2.47e-19	98	404	32	329	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1NHC_A	5.27e-19	126	399	47	310	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
1RMG_A	5.01e-18	39	400	8	331	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R060|PGLRX_ASPNC	0.0	1	435	1	435	Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaX PE=3 SV=1
sp|Q00293|PGLRX_ASPTU	0.0	1	435	1	435	Exopolygalacturonase X OS=Aspergillus tubingensis OX=5068 GN=pgaX PE=1 SV=1
sp|Q27UB3|PGLRX_ASPNG	0.0	1	435	1	435	Exopolygalacturonase X OS=Aspergillus niger OX=5061 GN=pgaX PE=3 SV=1
sp|Q5ASG9|PGLX1_EMENI	2.76e-248	1	432	1	433	Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgaX-1 PE=1 SV=1
sp|Q0CGP0|PGLRX_ASPTN	3.21e-247	1	432	1	433	Probable exopolygalacturonase X OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000370	0.999594	CS pos: 22-23. Pr: 0.8952

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_136710-t33_1-p1.