CAZyme Information: ASPFODRAFT_132651-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_132651-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: glycosyltransferase family 69 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		50439.88	6.3053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878240:1156046-1157398(-)

Full Sequence      

MNFNVRQVQTQLFRLTVSTASLCFLLFLYISFEWSPSASAGSSASNYEDDLDSAVPAISA
CNGFNPATVADVLDETLTAKLPINGSAVDDFVCSIMTHDMSLSAKLDCPATISPRYADLP
VRASKSLLSKPKIKYFFALDLYQSAHIMLPLMGTIVETMRFLGPEYCALSIVEGRSTDGT
YDILNRLKSEMAAMGVRYYLSTSDLNPKAVWEDRIKHLSTLRNQALEPLVSAGAGKLKPY
AADATILFINDVVLCVEDLLELLYQHQKQDARMTCAFDWNAAGGPFYDSWVSRSMSGNLF
FEITHDARYWLTKDMFFDDQPNQQRYARKLPVQVYSCWGGMVILDAAPFVQRKLEFRNHK
DGECHMGEPTLLAKDMWGQGLGKILAVPSVNVAYEYKATREAKKGQGYVHNVLESADYKA
GKEMVVWEKEPPVRIKCMPLFNQQSWVKST

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_132651-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	134	377	8.7e-80	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	2.32e-92	134	372	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01113.1|GT69	0.0	1	450	1	450
BCS12865.1|GT69	0.0	1	450	1	450
CAK38727.1|GT69	2.67e-307	1	450	1	452
BAE64674.1|GT69	4.78e-158	9	446	18	443
QRD91215.1|GT69	2.90e-157	9	446	30	455

PDB Hits     

ASPFODRAFT_132651-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	5.91e-41	106	439	106	443	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000005

TMHMM  Annotations     

Start	End
12	34