CAZyme Information: ASPFODRAFT_130535-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_130535-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	KV878239|CGC4	43114.96	4.5626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878239:226704-227864(+)

Full Sequence      

MYNLLGYLAALGCAQSALAAPLASSSNSSYIDWRTFKGNGVNLGGWLVQESTIDSYFWDK
YSGGASDEWGLCEHLGAQCGPVLEHRYATWITKADIDKLASAGITVLRIPTTYAAWIDLP
SSQLYSGNQTAYLREIADYAINTYNMHIVIDTHSLPGGVNGLTIGEATGHWYWFYNETNF
NYSLQVIDQVINFIQTSGSPQSYTLEPISEPADNNTNMVVFGTPLALTDHGAAWVLKYIR
AVIQKVASVNPNIPVMFQGSFKYPQYWEGDFPASTNLVFDTHHYYYEHMESSSANLPEYI
LADAREKSGTGKFPVFVGEWAIQSTYNNTLALRKRNVLAGLDIWQNYSQGSAYWTAKFTG
NTSVDGQGEQKDYWCYETFIDEGYFS

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	87	367	1.5e-153	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.24e-07	90	356	24	268	Cellulase (glycosyl hydrolase family 5).
225344	BglC	6.52e-07	35	181	15	161	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR97554.1|GH5_23	7.70e-299	1	386	1	386
BCS10017.1|GH5_23	7.70e-299	1	386	1	386
CAK39791.1|GH5_23	1.07e-280	1	386	1	386
QHN63926.1|GH5_23	2.06e-278	1	386	1	386
BAE61018.1|GH5_23	4.29e-201	5	384	5	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1A_A	3.02e-268	20	386	4	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6LA0_A	6.39e-197	20	384	1	363	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6ZB9_A	8.91e-12	37	385	2	386	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.05e-11	37	385	2	386	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	2.17e-28	14	320	17	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	3.01e-23	27	321	28	314	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|Q0CR35|EXGA_ASPTN	3.29e-23	1	320	2	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	1.54e-22	40	321	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	1.54e-22	40	321	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999720	CS pos: 19-20. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_130535-t33_1-p1.