CAZyme Information: ASPFODRAFT_123711-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_123711-t33_1-p1
• CAZy Family: AA16
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553		60098.75	4.9903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878237:2244178-2245839(-)

Full Sequence      

MSDSFDYIIVGGGLTSCALAGRLAEKDESLRILIIEAGPNVVDHPLTSTPLACFGAHHSP
LDWDYTTVPQKHLNDRECYNAAGKALGGGTAINYGTWTRGNAADYNIWAKLVGDSSWSYE
GLLPYFKRVETHYDPNVDQAIHGTSGPITNTIVELTSPDRKYPLKEPVRSAWERLGVKFN
PDANAGSPLGLAHFGENWCEGQRQLASEAYGLSGRQGITIVTDTLVAKVVLRDQDGEQVA
TGVQVVDGQEYHATREVIISAGAYRTPQVLMLSGIGPAEELAKHNILQLVDAPEVGRNFH
DHMCFPQWWKLRHPEQGLSMGTPLWDSPAYGMGVPYDWNVTLQTPAEELIKAFKADDGQN
PPKDHPYFEAGFAHTEVLVIYAPMSRAVTGFETAMDGTHISTAVLLMAPTARGQITLANA
NPESAPVIDPNYCSKEVDRAIFRDGIRRVAKLILDTPEGQDMVEHEVPRPGSEPITLEST
DEEIDSNIKSGAITFFHPGGSASMGKVVDTQLRVKGVKGLRVADASVLPVPLAAHYQAIL
YAVAEKAADLLLN

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_123711-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	552	1.5e-149	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.45e-97	1	552	2	532	choline dehydrogenase; Validated
225186	BetA	1.98e-94	1	553	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	2.23e-60	6	552	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	2.97e-38	74	304	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.97e-37	409	547	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16263.1|AA3_2	0.0	1	553	1	553
BCS04695.1|AA3_2	0.0	1	553	1	553
CAK40717.1|AA3_2	0.0	1	552	1	552
EAA58856.1|AA3_2	6.71e-248	5	553	6	555
BCS24407.1|AA3_2	2.69e-244	6	551	5	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.26e-69	5	551	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.15e-69	5	551	7	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	4.39e-69	5	551	7	569	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	4.01e-60	5	551	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.12e-59	5	551	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	6.11e-147	1	552	1	519	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|A0A3B1EFP9|STR4_STRTC	1.35e-67	2	551	33	611	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q00593|ALKJ_PSEOL	6.43e-63	5	553	2	529	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.98e-62	5	553	2	529	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|P64264|Y1310_MYCBO	3.46e-62	1	551	1	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999462	0.000578

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_123711-t33_1-p1.