CAZyme Information: ASPFODRAFT_121923-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_121923-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	KV878236|CGC3	58168.81	8.4336

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878236:933984-935667(+)

Full Sequence      

MSYGYRYGSIDTTTAINIRSSTPCILFLTNSEREHSSVILAVAHEFLIGNTPYKIHIGSF
GPLKRHVSELNYYAAASESPFATEAAFEEIPGMSMKHVRMRDGQFDDIPQIGFFAALRNY
RSDLALGLMPWTGRDYIEIFNGVVDLVKSLGPVLIVVDPLFAPAVDVCRYLRWRHVLLGK
GGVKDYVVKWKLSDLMKYPMICSGFKMPMSIWDKLRNLFLGFRFKHELDKCESLKELNEA
REARGIEGPLPFMSHEAKKSSRVIIPSWPETDFPLIVPEHMTLCGPILRRYRPMVKEDPE
LEHWLSKRPTVLVLMDARFTYEGKQQIEIAKALSMLLEQELNIQVLWKLKHVDDPAVTRE
IVKLLGVYIHGKRMRIMKHFVFETMSLLMSGHISCVVNYGGANAFHEAVRAEVPQIVLPV
WFDAYDFAARVEYLGIGIWGSRRSAPGVSGEELGNALLRVMADTDESYAMRMRAMQVSGQ
LPFKDGRVVAYEKLLEVLSQPWAPPHTRIRG

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_121923-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.87e-19	105	476	54	386	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.92e-07	396	482	304	386	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	2.59e-06	256	477	217	428	UDP-glucosyl transferase
223071	egt	2.20e-04	333	473	317	440	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS08887.1|GT1	0.0	1	511	1	511
BCR96374.1|GT1	0.0	1	511	1	511
CAK47643.1|GT1	0.0	1	511	1	509
BCS26405.1|GT1	4.16e-121	21	499	2	484
BCR88350.1|GT1	2.54e-119	23	507	2	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RRV_A	3.39e-06	393	500	303	401	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	1.72e-72	23	459	6	436	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	9.08e-63	18	461	1	466	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	1.97e-07	380	461	447	526	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	2.41e-06	396	461	464	527	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_121923-t33_1-p1.