CAZyme Information: ASPCADRAFT_60671-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_60671-t33_1-p1
• CAZy Family: GT69
• CAZyme Description: glycoside hydrolase family 51 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628	KV907670|CGC1	68141.55	3.9798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907670:2581-4823(-)

Full Sequence      

MVAFATLPGISALPLLLSLAQRVHGISLEVSTHGGNSSSSLLYGFMFEDINHSGDGGIYG
QMLQNPGLQGTIPNLTAWAVVGDATIAIDGDTPLTSAIPSTIRLDVSKDTTGAVGLTNEG
YWGIPVDGSEFKSSFWIKGDYSGNITIRLVGNSSGTEYGSTTFTHTSTADKFTEATAKFP
TMKAPDGNVLYELTVDGSVAAGSSLNFGYLTLFGETYKSRENGLKPQIANVLADVKGSFL
RFPGGNNIEGYSPENRWKWNETIGPLEARPGREGTWTYYNTDGLGLAEYFYWCEDLGLAP
VLGVWDGFALDSSGGTPLTGDALTPYVDDVLNELEYILGDTTTTYGALRAANGQQEPWKL
TMVEIGNEDHLGGGCDTYPERFTRFYDAIHAAYPDLILIASTSETDCLPDSMPEGSWVDY
HDYNTADGLFGQFNYFDNLNRSVPYFIGEYSRWEIDWPNMQGSVAEAVFMIGFERNSDLV
KMAAYAPLLQLVNSTQWMPDLIGFTQSPDMTFLSTSYYVQEMFSTNRGDTIKQVTSDSDF
GPMYWVASSAGDAYYVKLANYGADTQDLTVTIPGTTTGELRVLADSNPEAYNSDTQTPVI
PSESTVQASNGTFTFSLPAWAMAVLAAN

Enzyme Prediction     

EC	3.2.1.55:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	214	450	3.1e-52	0.3682539682539683
GH51	433	626	2.6e-47	0.37936507936507935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214830	Alpha-L-AF_C	3.19e-41	452	620	12	188	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
399741	Alpha-L-AF_C	2.37e-32	458	620	22	191	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
226064	AbfA	1.46e-28	212	625	38	496	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAC41644.1|GH51|3.2.1.55	0.0	1	628	1	628
CAA01904.1|GH51|3.2.1.55	0.0	1	628	1	628
ADG21260.1|GH51|3.2.1.55	0.0	1	628	1	628
AAE37582.1|GH51|3.2.1.55	0.0	1	628	1	628
BCR95291.1|GH51	0.0	1	628	1	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	7.60e-136	26	625	1	622	Chain AAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
2Y2W_A	4.13e-12	221	368	89	215	Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_B Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_C Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_D Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_E Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_F Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum]
1PZ3_A	4.43e-11	221	368	49	175	Crystal structure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],1PZ3_B Crystal structure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],6SXU_AAA Chain AAA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXU_BBB Chain BBB, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXV_A GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus],6SXV_B GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus]
1PZ2_A	1.79e-10	221	367	49	174	Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1PZ2_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus]
2C7F_A	1.19e-08	218	367	54	182	Chain A, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_B Chain B, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_C Chain C, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_D Chain D, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_E Chain E, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_F Chain F, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C8N_A Chain A, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_B Chain B, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_C Chain C, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_D Chain D, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_E Chain E, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_F Chain F, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CTV2|ABFA_ASPTN	0.0	1	628	1	628	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
sp|B8NKA3|ABFA_ASPFN	0.0	1	628	1	629	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
sp|Q8NK90|ABFA_ASPKW	0.0	1	628	1	628	Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=abfA PE=1 SV=2
sp|Q2U790|ABFA_ASPOR	0.0	1	628	1	629	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2
sp|A2Q7E0|ABFA_ASPNC	0.0	1	628	1	628	Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=abfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999735	CS pos: 25-26. Pr: 0.9578

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_60671-t33_1-p1.