CAZyme Information: ASPCADRAFT_55858-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_55858-t33_1-p1
• CAZy Family: GT59
• CAZyme Description: glycoside hydrolase family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	KV907508|CGC4	88579.33	6.1532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907508:34919-37291(+)

Full Sequence      

MADTDWNRSAPWIWLPRYREEDNRPGRFFLFRKTFHWHAPFPDPQRIPVLVSADSRYRLF
VNGHRVSFGPCKSHPGTWYYETVDIRPYLVAGENVVSARVLRYSATHPGSLSIVSQPLPG
FMLITSYLDIATDSPWRCREEASARIIPPTEWNYILGPPLLTNNERVAEDAALTGWQTAG
YDDAAWDDAVPQSNAVKMLPVDSLWNLTPRPIPALPETPGRFDGIVQSTGAVSAEQWHAL
IRDDQAVRIPAGEQVVVDLRVDALLTAFVTFRFRGGAGAKVRILYAECYEKDLGVDTAPF
PLPRTKANRSDATGRLYGPQDFYTVTAGQPAHAFEPFWFRCFRYVQLAIDTTTEPLTLTA
IALRETSYPLAITTQLDAGAELNQIWAISLRTLQNCRHETYEDCPFYEQNQFAADSRLQL
LFTYQLSPDDRLARKTLEEFHASRTPDGLIVAQYPTGHPTKQIPLFSLFWILMVHDHMMY
VADRSVVRRYLGTVDGILEHFEARLDQRGLVGHFDPNAWPFVDWVQEWMRPGRIFQSCMP
PAYYAAGAATVNSLLYAYALMHAAELCDWVGRQSTAEEYRARVQAIRSAVNAHCSTESLY
QDGPGVEQYSQHTQIFAILSETVTGAAATHLLRRTVADASLAQCSYAMQFYVFRAADKAG
LYGELLPALLHPWRAMVAQNLTTWAEDAVNARSDCHGWSASPVHEMVTQVFGVTPTAPGF
ARVRIAPRREVVEAAEGVLYTPRGEVQIQWGRGRGLTVESTGEMAAEVVVAGRASECVLR
PGQPVVFDAP

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	254	767	1.5e-101	0.9781746031746031
CBM67	10	193	6.1e-33	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.13e-16	382	702	13	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	1.60e-08	57	193	16	154	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	1.82e-04	265	347	16	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	0.002	712	778	1	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
397120	Glyco_hydro_2_N	0.006	54	104	92	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15768.1|GH78	0.0	1	787	1	789
BCS04174.1|GH78	0.0	1	787	1	789
CAK49119.1|GH78	0.0	1	788	1	790
QDS72372.1|CBM67|GH78	2.68e-302	1	772	1	776
BCS25990.1|GH78	3.92e-252	6	772	5	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.50e-32	340	750	503	917	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	2.67e-13	341	702	172	534	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

ASPCADRAFT_55858-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_55858-t33_1-p1.