CAZyme Information: ASPCADRAFT_515722-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_515722-t33_1-p1
• CAZy Family: GT34
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	KV907500|CGC7	38175.61	4.0241

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907500:920007-921209(+)

Full Sequence      

MHSIQLLGLAAVGSLVSAAPAPSRVSELVKKSSSTCTFTSASEASESISKCSNVVLSNIE
VPAGETLDLSDAADGSTITFEGTTSFGYKEWKGPLIRFGGKDITVTQSSGAVIDGDGSRW
WDSKGTNGGKTKPKFMYIHDVEDSTFKGLQIKNTPVQAISVQATNVYLTDFTIDNSDGDD
NGGHNTDGFDISESTGVYISGATVKNQDDCIAINSGESISFTGGTCSGGHGLSIGSVGGR
DDNTVKNVTIADSTISDSANGVRIKTIYKETGDVSEITYSNIQLSGISDYGIVIEQDYEN
GSPTGTPSNGIPITDVTVDGVTGSIDDDAVQVYILCGDGSCSDWTWSGVDITGGKTSSDC
ENVPSGASC

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	49	364	2.6e-74	0.9692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.37e-148	51	369	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.92e-26	51	363	95	420	polygalacturonase ADPG
215540	PLN03010	1.03e-25	89	368	122	394	polygalacturonase
215426	PLN02793	2.48e-24	51	360	80	406	Probable polygalacturonase
227721	Pgu1	4.20e-20	73	287	174	398	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA41693.1|GH28|3.2.1.15	1.47e-244	1	369	1	368
CAK44054.1|GH28|3.2.1.15	1.47e-244	1	369	1	368
BCS06061.1|GH28	3.46e-243	1	369	1	368
BCR93418.1|GH28	3.46e-243	1	369	1	368
ACS44814.1|GH28	5.73e-228	1	368	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NHC_A	1.26e-229	34	369	1	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	9.63e-164	36	369	11	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	9.63e-164	36	369	11	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	2.40e-162	36	369	3	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
2IQ7_A	3.12e-149	36	367	3	335	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QAH3|PGLR1_ASPNC	2.61e-245	1	369	1	368	Probable endopolygalacturonase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaI PE=3 SV=1
sp|P26213|PGLR1_ASPNG	2.61e-245	1	369	1	368	Endopolygalacturonase I OS=Aspergillus niger OX=5061 GN=pgaI PE=1 SV=1
sp|Q70HJ4|PGLR2_ASPAC	2.86e-224	1	369	1	369	Probable endopolygalacturonase II OS=Aspergillus aculeatus OX=5053 GN=pgaII PE=2 SV=1
sp|A1CVV8|PGLRA_NEOFI	4.56e-223	1	369	1	368	Probable endopolygalacturonase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgaA PE=3 SV=1
sp|B0Y4Z4|PGLRA_ASPFC	1.25e-220	1	369	1	368	Probable endopolygalacturonase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999781	CS pos: 18-19. Pr: 0.9825

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_515722-t33_1-p1.