CAZyme Information: ASPCADRAFT_514147-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_514147-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: glycosyltransferase family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		70522.89	5.6800

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907497:598296-600173(+)

Full Sequence      

MRTQRFVVWLGTFVLASLFLICFRDTNPSPAVNGFPSPDPRPSAIFQRPAVPPNAQLIEQ
TTNREVAQPNGIHPIASLVENAEQHSDRLLARQSKTLAQAVTEYRTRYNMHPPPHFDKWF
QFAKDRGVQLIDEYDTIYHALLPFWALEPKTIRERARETLGFDNSMIGILIRNGSVSLAE
GGAYEQSWQRSATVKMIKSFVEYLPDMDLVFNALDEPRVVVPSEDLQRLVVIAKDRISQD
TVRNTMPTNVWSDRSTDLNKGDRIDEVRTTRFNRFAHQSTWSYSRSSCPVDSPVRSLDEQ
AADNTNSYARGELGFIYNTTAFSDICNSPSFRYKYGFFDRPNMFEAVHDLFPVFSQSKIS
SYQDILYPSPWYWADQVPYEEDKDFEWEEKIDKMYWRGSTTGGYSRAGGWRRQHRQLFVG
NVNALNTAKVLTEADHGQWKARGVGRNSFADRFDVRFTYIGQCDEEDCAAQREYFDVAEP
VDQQDAWAYKHLLDMDGNAFSGRFYAFMHSKSLVYKISIFREWHDEWLKPWAHYVPLSLT
GDDYLEAIRYFESEDEGKVIAPRLARQGREWAQKALRNEDMETWFFRLLLEYGRLVDDNR
QNLGFSP

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_514147-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	329	596	3.1e-83	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.62e-23	348	595	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	6.37e-12	352	595	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43248.1|GT90	0.0	1	606	1	608
BCS10289.1|GT90	0.0	1	606	1	608
BCR97835.1|GT90	0.0	1	606	1	608
UCK57446.1|GT90	3.22e-309	1	606	11	618
BAE54850.1|GT90	2.59e-308	1	606	1	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.23e-10	352	596	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	1.00e-09	339	599	105	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.51e-54	60	602	138	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.19e-10	346	596	158	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.57e-10	352	596	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.10e-09	339	599	133	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.19e-09	352	596	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.986495	0.013528

TMHMM  Annotations     

Start	End
7	24