CAZyme Information: ASPCADRAFT_513282-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_513282-t33_1-p1
• CAZy Family: GT31
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845		92262.18	8.3441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907495:2356625-2359532(+)

Full Sequence      

MEFPSRHGHGDTASLDEQAPPPYSPYVDGGLVVESADVQADGRINVDLDSRFARTLAKVI
ELQQEDLQNPPPGYLWGQSVQDHTVRCDIQLNIVIQIVGSRGDVQPFVALGNELQNYGHR
VRIATHNVFAEFVTQSGLEFYPIGGDPAELMAFMVKNPGLIPKMEGLRAGEVQKKRAMVA
EMLEGCWKSCLEDDPVTKAPFVADAIIANPPSFAHIHCAQALSIPVHLMFTMPWTSTKAF
PHPLANLSSSNMNPRTANWVSYGVVEWLTWQGLGDVINQWRASIDLEPVSTTEGPRLAET
LKVPFTYCWSPALVPKPQDWPKNIDVCGFFFREPPTYKPPPELQEFLNSGPRPVYIGFGS
IVIDNPRKMTEIILEAVARAGVRAIISRGWSKLGGASGPNMYYIDDCPHEWLFQHVAAVV
HHGGAGTTACGLANGRPTTVIPFFGDQPFWGQMVARAGAGPKPIPYASLDARVLADAIAF
CFTPAVASSARNIALKMQHESGVTAAVQSFHRHLPLNKMRCSLIPSQPAIWSYTRSKGNI
NLSKTAVQILINNCKIDVKHLRCHDINPIYIENRRWDPVTGILSASTSTGSEMIKSTAAM
LYDPYKEYTRGRSGKSPRAHTERGLSPFSPASSSQSSKHLPEAERQPSGLGATMTRANSD
PSKSSLSTAGSMVGASLKGFGKFTGAYFKGIVVDIPHAAAEGFRQVPRLYGEEPKDYGTV
RDWKSGATMGGRNFVDGMTDGFKGFFTEPVKGAREDGALGAVKGFAKGTIGLATKVPSAG
IGLVAYPFHGIAKTIETAVRSKTRKAIVNARLREGYEVTRQLNLSEDEQQDLLQRFQLLT
HRLDT

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	118	513	5.8e-53	0.9659685863874345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.21e-86	91	513	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.93e-46	93	508	4	389	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.47e-24	93	241	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	2.86e-07	726	776	2344	2394	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].
273616	MGT	9.64e-07	102	502	7	377	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48301.1|GT1	0.0	1	840	1	841
BCS15859.1|GT1	0.0	1	839	1	840
BCS04269.1|GT1	0.0	1	839	1	840
CAP79869.1|GT1	0.0	19	845	18	846
BCS26658.1|GT1	0.0	1	839	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.18e-77	98	514	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.01e-77	98	514	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.31e-31	91	506	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.48e-28	91	506	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.65e-23	91	460	1	347	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	1.03e-132	31	538	139	635	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	8.11e-128	31	515	103	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	1.80e-76	91	529	1164	1624	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q5A950|ATG26_CANAL	2.98e-75	85	518	1009	1437	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2
sp|Q9Y751|ATG26_KOMPG	1.68e-74	64	518	734	1182	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_513282-t33_1-p1.