CAZyme Information: ASPCADRAFT_509008-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_509008-t33_1-p1
• CAZy Family: GT20
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	KV907505|CGC3	52305.54	4.3322

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907505:1020860-1022720(+)

Full Sequence      

MMLSSLVLLLWSSLAAGQLIGPVGPTTPLAQKTVECNVLDYGAVADNSTDLAPALESAFS
ACVLPNPGSRLVVPAGDYLIQRGVVLSNATNWAFQLDGLITAAYGGNWTIERALILQGFA
GVDLLNATINGEGDHKFLLDVLVIVNAVDFEFYSSNGLGAFQGQGYLYRNLNNTDRPRLV
RLISPTNATVHDLILVDSPKFHLVLDFAVNVEVYHITVRGANLGSYDGIDAIGTNYYIHD
SEVTNRDECVSIKSPSHHALIENLVCNQAGSGVSIGSLNVSAEISDIVAQNISIIQGNNI
AFIKTYPGGSGYVRNVQFLNFRSKASLYGLNINQYWQNTFEPDTGAVALSNLTFRNFSGS
VADGARRPPLYLIANDLTYATDVTIEDFTVWTESGDDVVNKINNIFGTGDDSYGPNDGIA
SLASGATPTTYTSTYTITASPTGWVAPTSPAWAAPSTGYGTASPIPVYTPAALWRPGGVD
YDLHYWGSF

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_509008-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	149	396	4.8e-50	0.7353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	1.35e-22	37	412	48	396	polygalacturonase
395231	Glyco_hydro_28	3.94e-21	159	405	61	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	1.61e-18	38	362	55	369	Probable polygalacturonase
227721	Pgu1	2.03e-18	20	318	68	390	Polygalacturonase [Carbohydrate transport and metabolism].
177865	PLN02218	2.53e-18	37	362	69	383	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82401.1|GH28	6.06e-309	6	489	4	487
BAE57693.1|GH28	2.46e-308	6	489	4	487
QQK39531.1|GH28	6.03e-298	1	489	1	489
QMW40025.1|GH28	6.56e-285	6	477	4	475
QMW27954.1|GH28	2.67e-284	6	477	4	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	1.14e-95	18	482	1	418	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	1.64e-06	177	384	151	366	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	1.39e-103	1	482	1	436	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2QYE5|RHGA_ASPNC	5.61e-102	6	477	7	432	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	1.12e-101	6	477	7	432	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|Q00001|RHGA_ASPAC	3.22e-96	13	482	14	436	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|B0Y0Q3|RHGB_ASPFC	1.68e-95	13	482	17	441	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999739	CS pos: 17-18. Pr: 0.9707

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_509008-t33_1-p1.