CAZyme Information: ASPCADRAFT_505924-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_505924-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		69286.06	4.7126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907497:2230823-2233048(-)

Full Sequence      

MSSHLRSVALLSLFLGSAVSTPFVYHRRPQFQQYLGAETNENPPDPTDPYDYVVVGGGVT
GLIAAARLAEASYRVAVIEKGDYYEQMTGNLSEVPGYTELFDNSKTPPRDEVEYWWEVPG
TPETNYRPLNFTGGKMIGGSHAFSYFGYLQPTVGALQKWADDVGDQSWTYANTKQYFDKS
IFFTPPNGTTRLTNSTPEYPPDLKGSGPLEITYPRWVHPFSTWLAKAFDALGVPHALGYV
AGELLGSSWILDTINSTDGTRATTWTAYIKDKPVQSQIDIFTNTLAEKILFDGKKATGVQ
ATRYLNGEDSKSVNISATNEVVLAGGGILSPQLLMVSGVGPAKQLDRLNIEPVLEQEAVG
QNMHDHIVFGVTYKVKVPTSSILLNETILWQQQDLFQENVTGMLTNPGPDYGAIVNIPRE
LRNFTQDVKDDLAALPHDWPELIIVGFPLGHDWPNDGNYATLMGIPMTAKSVGSISLCSA
HMTDKPNVIPNWLTSQTDLQVSIASLRYMRRVFEDAEMVDIIDSDEISPGPEAATWDEIE
DALKSGYRSMHHPAATLRMGRSGDPNAVTDSEGRIMGLENVRVVDPSAFPFLPPGLPLAP
AFMFAEKITDNIINDQKKKSRHGKERTGL

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_505924-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	50	614	2.3e-148	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.39e-63	63	617	21	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.00e-57	65	612	21	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.58e-31	470	608	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.79e-19	120	368	10	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.74e-14	287	603	244	567	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43129.1|AA3_2	0.0	1	629	1	637
BCR98269.1|AA3_2	9.74e-172	1	303	1	303
BCS10611.1|AA3_2	9.74e-172	1	303	1	303
CAP40103.1|AA3_2	2.33e-150	1	615	1	648
CAK42459.1|AA3_2	2.33e-150	1	615	1	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.13e-42	50	617	6	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
2JBV_A	1.06e-41	50	612	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.45e-41	50	612	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
5OC1_A	1.87e-41	50	616	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3LJP_A	1.98e-41	50	612	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2V5GRB0|PYVF_ASPV1	2.97e-165	7	629	7	625	Dehydrogenase pyvF OS=Aspergillus violaceofuscus (strain CBS 115571) OX=1450538 GN=pyvF PE=3 SV=1
sp|A1CFL2|PATE_ASPCL	3.58e-116	15	612	23	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.54e-114	26	612	31	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	8.17e-113	50	615	36	610	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	6.69e-99	50	612	41	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.350684	0.649295	CS pos: 20-21. Pr: 0.6093

TMHMM  Annotations     

Start	End
7	26