CAZyme Information: ASPCADRAFT_45592-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_45592-t33_1-p1
• CAZy Family: PL26
• CAZyme Description: glycosyltransferase family 4 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	KV907497|CGC6	73748.10	5.7973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907497:1950902-1953139(-)

Full Sequence      

MASVSPSFNADAWAGRPLNIIYAGITELVSDTSGGRVAIAIRNSTDLVDLIVCTLHAPRP
DASDYATCEIVSELKRYREKHGEKIISAALHKSLVGKCPSLCSRLWGELDIVPLVLDHKD
RERQHDDQGELATFSGWHKKELDEQADSMVRKCIRSFGIGHVLHNHINFDGSVDVDRSYH
VHLASCDDYEKTVAPTTWSVAQHYAHDLSQRRVKIAFFSMTCQGKPDVPTRHALARFTQS
LGVSIKWFVPKPRPGMIPLIRKMQDTLEGLGDSHPDITINDELLILDFAYANARRYWLCE
SGPLRPRAEGGVDVVVIDSAPLLTLALLSKQQDPERPVIFESSLQPQGDSIGDPNSPQSR
AWEFIRTRLAHVDMVVSLLPKELAPRIMPEDNVGYIPFSVDQLDGQNKPLTDWDMVFYGR
EFSSLCRTLQMSIIRFPEEQYMLHLSQFRPGDGTLCLLESYGKSRELFSKKYPGQAFPKL
LICHHGPFRSPESSMLYDAVMTQLDNIESLASSVCIIPIGALDQMWNALVTNAVALVQLS
TLHGVPELLLGAIQKETLVISIREAELFPFVRENKNAVLVNPADTDAIAQDLVRIFGDEQ
PSSKKVFTRNSKLADEYTTVGNALSWMYLASKLSRGDKFEPRGGSINGLAIEEAEFYDFD

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_45592-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	6.69e-89	214	633	1	378	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98080.1|GT4	0.0	1	655	1	655
BCS10530.1|GT4	0.0	1	655	1	672
CAK47237.1|GT4	0.0	1	660	1	660
QMW47856.1|GT4	1.16e-217	12	654	19	663
QMW35794.1|GT4	1.16e-217	12	654	19	663

PDB Hits     

ASPCADRAFT_45592-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6YRN9|TREPH_PLEPU	4.34e-93	18	653	40	718	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|O75003|TREPH_GRIFR	6.46e-87	18	653	36	711	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|Q9UV63|TREPH_PLESA	9.62e-87	18	653	40	730	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_45592-t33_1-p1.