CAZyme Information: ASPCADRAFT_44494-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_44494-t33_1-p1
• CAZy Family: GH92
• CAZyme Description: glycosyltransferase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	KV907496|CGC8	51313.97	8.9778

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907496:1495173-1496712(-)

Full Sequence      

MMSSSSNRPGLLNPRQPVKALTVAFCLWKALVYLVIISCPGLGYDTSTSHLYHTNGRSDV
ISSEDLTYAHLPIPLKFVRWDSIYFLHIAENGYVFEQEWAFGYGYTRALAFIATGRYTCP
SGVARTAVVAIALSHLAHYLSVLALYRLSVNVFGRDTATQRLICFLSAALHIICPAGAFL
SAPYGESLFSLLNITGFYVYSSSFLDNKAGKRLSADVKLLLAAVLFSAATTVRSNGILSG
ILYAYDALLQLRRVLCQRLSVGACAHLCVIIVSGCVIALGLVIPQTVAYTAYCVDDDIPR
PWCRWLVPSIYGWVQGHYWYNRNVGFLRYWTVSNIPLFVLAMPMLAILCRSSLWALDVAV
PFIFPGALSGVDQASSSATTASLLLRLAVPQGLLAIMALTSYHVQIINRISSGYPLWYWY
LVYLVSGNWGQSRPSLQDSRGFAVAVRGMVAYALIQALLFGSFLPPA

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_44494-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	23	467	1.3e-112	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.37e-37	18	467	1	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	8.19e-19	79	467	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01167.1|GT76	3.62e-293	3	467	7	469
BCS12914.1|GT76	3.62e-293	3	467	7	469
CAK38795.1|GT76	4.39e-291	1	467	5	466
QMW40534.1|GT76	1.70e-193	8	467	9	452
QRD82967.1|GT76	6.88e-193	8	467	9	452

PDB Hits     

ASPCADRAFT_44494-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	1.08e-187	8	467	9	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	2.76e-165	11	467	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	3.25e-77	17	467	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.48e-75	16	467	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.79e-43	21	467	7	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999944	0.000066

TMHMM  Annotations     

Start	End
21	43
127	149
162	184
188	206
219	241
261	283
326	348
353	371
384	406
416	430
443	465