CAZyme Information: ASPCADRAFT_4197-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_4197-t33_1-p1
• CAZy Family: GH92
• CAZyme Description: glycoside hydrolase family 71 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	KV907497|CGC6	90870.16	4.2583

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907497:2106006-2109665(-)

Full Sequence      

MFGLKGVATLAVAAVLGHKAAAKAVFAHYMVGTVTQEHVQKDIDDAKALGFDGFVLNIGD
ATQSYVSDTLSYMFPYAESVGFKLYVSMDVYTSGAACYKIKTSCNGPFDYQWIWDGYKGS
SAYYQVDGKALISTFSSGGFHNTNWTEWKNGLANDMFFMPDFDETDGYYKAADAWWDYWG
DIVDGILSWETAWPVRKGLGGLTAGHVSVDVLPMTGAHNCSKPYMMGLSPLQYKNAYGTN
VYRQGDLNLPKRMESILQMEPQPDYNDGPESHYIGNLWVEQNNDTQPWFYANQEYWPHTG
WQPLVASFIDAYKNGMKPSEMTPQSSQVTGAMWYKTILVDSVACGYESASQFYEKPDGFD
KAADDVWWAIILSPHAGTGWKYIVSGEVDHENALSPGFNWGSSAGKVAGAQKLQVINPSG
DVVMSATGGLCVDSGCPNLLYNSNYQVLGLEDGDKSKECTAISDAEDTSCTGSGCKTTVF
DGNGPSAWRNVDCTWFSVENASIDAATRWNTIFTESAWTDLNQYWLGHPHEGGLNYSNGI
SNLVHGPEHMDCSVMADSVGCALTKIPFYADNPLKLSNSKDVTNALVGNGVTIIKDVIAT
DSTPVQLGVENTLETRLDTVVQFWYSTIDSLNESLFNGTSASIDILHNLMTDGKLLETSF
QVPSDQEITQIVEKAIFGLLIPLTWTLSPDTHNAVVVDSQSTCDKSSPLSAYISSSVAKS
GYVCYNNNIYYLVDVVSLDRSCESNSQGGQLCRDPDVRELPGIGALDGSSWGGITVEDLV
VGAVNTWTQQSNTSAFLDPSDIGALDDIYDQGIRSAGVVHIPVGTISELKKSIN

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_4197-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	25	417	9e-50	0.9733333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	1.03e-86	25	423	1	371	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	3.04e-66	20	315	2	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	3.40e-16	25	306	1	280	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI69917.1|GH71	4.72e-286	4	828	1	922
QGJ00805.1|GH71	4.72e-286	4	828	1	922
QKD60832.1|GH71	4.55e-281	4	828	1	922
CCT74490.1|GH71	4.15e-276	4	828	1	889
QGI87293.1|GH71	5.90e-262	4	828	1	855

PDB Hits     

ASPCADRAFT_4197-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	1.02e-14	23	434	22	409	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|O94510|AGN2_SCHPO	1.11e-08	23	445	11	426	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.986815	0.013176

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_4197-t33_1-p1.