CAZyme Information: ASPCADRAFT_405624-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_405624-t33_1-p1
• CAZy Family: GH78|GH78
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	KV907499|CGC5	65353.30	6.6026

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907499:946101-948128(+)

Full Sequence      

MTDSYDYIICGGGTSGCVVAGRLAENPHVRILVIEAGPHHKDLENVHMVGGWNNLFDDKT
DWNIVTPPMPNVNDRQIKLSRGKFLSGCSGCNGTLCIRGSKQDYDDWGLEGWSGEEFFKC
MQKVSAAFLSQEVAETFHGKPWFKSADQLHGQSGPLHVEPHDLAPISGLIMDSFISQGLP
LDHDMFTTGETPHGCGHVPRTVYNGLRTTSGDFVTNGYHRTNVTIMTDTTVDRILFKKTP
NGLKADGVVVVTANGQQLFFAKREVIISSGAYCSPTILMRSGLGPKEELQRNNIDCLVDL
PGVGQNLLDHLIVFMFYETEKPGLTTDHLVYHDENFDKTYALWRDKKEGFLSTFPFGSFA
FARLDDRLKDEPLWKNAPRQPGRDPMGLTPKQPNVEFFTTECYGGPKQYDQFPIDRKHAF
SIIAELFSPKSRGSVTLKSKNPLENPVVDCNYLADPLDLLVLTEACRFANEIITKGAGTK
DIVKGSWPPHLTHHTYTKREEWIPYVKENATTCYHAAGTCAMGSDGDPRAVLDNKLHVRG
VIGLRVADCSIMPTLHGGHTQMPAYGIGEKCADLIKETWSSQIMKVAKL

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_405624-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	577	6.1e-158	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.09e-96	1	576	2	532	choline dehydrogenase; Validated
225186	BetA	2.47e-96	1	577	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.19e-37	429	571	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.57e-27	69	312	11	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.80e-24	4	551	55	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07163.1|AA3_2	0.0	1	589	1	579
CAK49001.1|AA3_2	0.0	1	589	1	566
UDD65288.1|AA3_2	0.0	3	582	7	577
QMW48130.1|AA3_2	0.0	3	582	7	577
QMW36070.1|AA3_2	0.0	3	582	7	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	8.21e-76	5	576	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.15e-75	5	576	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.60e-75	5	576	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	6.71e-63	5	580	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	1.16e-57	5	576	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.48e-74	1	576	1	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	6.25e-72	1	575	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	9.04e-71	1	575	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	3.05e-70	5	580	41	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q988C9|4PADH_RHILO	3.25e-70	3	575	5	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_405624-t33_1-p1.