CAZyme Information: ASPCADRAFT_400689-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_400689-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: glycosyltransferase family 69 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		56973.09	6.8946

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907515:281512-283041(-)

Full Sequence      

MARLPFNPPEYYRLDRRSSADSTALLSVSDLDDEDVGLPRRTSPPAAGGLWSWCRGRAGF
RLFRRGSAGRHGRRLVALIRLAVGCLVVLIAVTGIFWPSYTHLPPHYQTLRRSAAQSGVS
GPGNPHDERIFIAAILYDQEGTLAGGRWGNALLQLIHLLGEDNVFLSIYENDGDVKGHQA
LRDLESKLPCNSSIHIDPHLDLSAFPRVTAPGGAQRIKRTNYLAELRNRALRPLDEHPEI
KYDKVLYLNDVIFDPIDVLHLLFSTNSDHTGVAQYRAACAVDFSNPFKFYDTYATRDLDG
YGIGLQFFPWYTTAGTGQSRQDVIAGKDAVRVRSCWGGMVAFDAQYFQRRDNPVRFRADP
DVFFDGSESCIIHADIQGPPSAEKQVSDTGIYMNPYVRVAYTERTYAWLWLTRRFEKLYS
IPHHLASQVAGFPHWNPRRSETPGQVIRETLWVPDATDARGGAFREVDRVAGNDGFCADG
FGGYRGLQVIVEDREPGQGGWEEIPMPST

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_400689-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	129	377	1.5e-83	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	3.75e-99	129	372	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44894.1|GT69	1.19e-256	8	508	7	508
CAP98184.1|GT69	2.40e-194	74	508	87	521
QMW39528.1|GT69	8.12e-194	9	508	9	526
QMW27457.1|GT69	8.12e-194	9	508	9	526
UDD55322.1|GT69	8.12e-194	9	508	9	526

PDB Hits     

ASPCADRAFT_400689-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPCADRAFT_400689-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000003

TMHMM  Annotations     

Start	End
75	97