CAZyme Information: ASPCADRAFT_399387-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_399387-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: glycoside hydrolase family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844		90954.23	5.1626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907507:924295-926911(+)

Full Sequence      

MSARRLAIFTCSSVLDTIALPTKYKTGTSFANYTSHGHASCVTLDHNKPLVTLDYGTEVG
GFPFFNVESLSGAVQIEAKYTETEAGLDAPFGDGPWTFSNGLSNTFRVETFNVTSTGRVE
SFFIQGGLRWQTLWLLTEGSVRICQAGIRSGNDRTPVDELPGFFESSNDLYNEIWALGPR
TVQQACIAADTAPSTWEVTTDGVYLRGQQPAQSVIGASFANYTLTFHTKIVRGGTGWKVA
AEVGGFGPYFVLTSEYPPGSSFANTNRTIVPPNTLTVGYGWNLVNQTSLTTGKINHYSLP
FDIQEGHWYEISTTINATGYGVAVNGTDIFVAVNDLQIVSGTTGSSGSLTGGTWGFGPYQ
DQIALVKDVEVHAQNGTRLYRNPMTSSSVLEEFGVMAGNHSVCLDGAKRDRLVWSGDFVH
TYRVIQSSTGRSDFVTGSLEYWLDRQAPDSSAYHGYFSMSPAMGQSAEYVTTYNAFGLLD
YQLFFLNAFAGYYRNSADKGFVLKHWKQIKNGVEAVRSLIDEQSGLAVATDIGAFFSGPS
NGTAVSAVLAHTLSEMANIATVVGETDVASTWARLADSIKDAIRDQLWNSHLGAYAADLS
DRTEQSITGSAWAILSGVSNTTQAESSIAALSSLRLGIGYKTSTSVSNASTTDLAPFLSG
FLLEAILQASRNSPSASHARATAISVLLDQLWAAMVTQDEYYTGGAWEYVYPDGRPGLDL
YTSHAHPWAAAPTYVLTEYVLGIQATAAGFSEWAFRPAILDVNVSWARGRVPTPHGPIRA
SWQLGQNDTVQLRVCGPSHTTGIVSLPFAVESYTVHGEDRTAVGDQFEVTVSGGSCTNVH
IVKK

Enzyme Prediction     

EC	3.2.1.40:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	399	806	1.5e-67	0.7341269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	2.90e-11	742	818	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	2.80e-09	492	740	110	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ93894.1|GH78|3.2.1.40	0.0	16	843	61	887
BCS14345.1|GH78	0.0	30	843	54	866
CAK46278.1|GH78	0.0	1	843	1	831
BCS02687.1|GH78	0.0	119	843	2	725
BCR89915.1|GH78	0.0	16	842	25	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.18e-10	404	793	331	684	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPCADRAFT_399387-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.784126	0.215888

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_399387-t33_1-p1.