CAZyme Information: ASPCADRAFT_394102-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_394102-t33_1-p1
• CAZy Family: GH72
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	KV907495|CGC8	80305.54	8.0724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907495:664545-667141(-)

Full Sequence      

MEPHDQPPPYEALPSNPWEGQESHVKDDGRVVVDAKSRLCRTISKLIPRAREEQHLAPPP
PGYWENIKPPYRLNIVIQIVGSRGDVQPFIALGTALQQCGHRVRIATHQVFEKFVQDSGL
EFYPIGGDPSQLMAYMVKNPGLIPRMSSVRAGEIANKQLMMAEILRGCWQSCIGVDPVTQ
APFVADAIIANPPSFAHVHCAQALGIPLHLMFTMPWSATRAFPHPLANLKNVSPDQDWIN
RVSYGVVDWLSWQGLGEVINEWRKSDLNLEPIAMSEGPFLLQTLKVPYTYCWSPALVPKP
DDWPANLEVCGFFFRDAPDYKPDAALAAFLSSGPPPIYIGFGSIVLEDPEKMTRMLVKAI
QQTGVRALISRGWSKLGGIECENIMYLDDCPHEWLFQRVTAVIHHGGAGTTACGLRYGKP
TFIVPFFGDQPFWGQMVAANGAGPNPIPHQHLSAQNLAEAILYCISPTAIEAAGRISARM
QHEAGVQAAVASFHRNLPEDLKKCDILPHFPASWVVKKGKKRYHLSKVATEILLDHMKIA
RDKMQPYQSKPIIIENERWDPITGVSSAGLGWTVDMLKASGDIVYQPYKVLKQNAQLRRA
KSMSDMNVVTEDEPTKRHKAAAMASASAKASGTLLGKYVSGAMVDIPLAAAEGFRVLPGL
YGDNVHDYGHVKDWKTGTIAGAKCFAVGMGESVTDIFYQPYRGAKDNGAVGFATGMLKGT
FGVVGKVAHGR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	140	494	1.2e-55	0.856020942408377

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.59e-78	73	495	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.09e-42	75	495	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.14e-22	75	223	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	3.01e-06	332	485	223	377	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	0.001	337	443	278	385	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK58945.1|GT1	4.93e-311	5	731	19	748
QRD87509.1|GT1	2.83e-310	5	731	19	748
QMW26390.1|GT1	4.78e-307	5	727	19	743
QMW38469.1|GT1	4.78e-307	5	727	19	743
BAC56174.1|GT1	7.29e-307	21	731	36	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	7.98e-77	61	497	8	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	9.68e-77	44	497	12	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.04e-30	73	489	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	5.30e-30	73	476	1	365	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	6.43e-26	73	443	1	347	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	4.87e-129	73	498	193	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	4.75e-126	72	501	155	578	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	8.06e-80	25	497	944	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q0UY53|ATG26_PHANO	1.77e-75	66	443	946	1318	Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=ATG26 PE=3 SV=1
sp|Q5A950|ATG26_CANAL	3.51e-75	61	497	1003	1433	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_394102-t33_1-p1.