CAZyme Information: ASPCADRAFT_392578-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_392578-t33_1-p1
• CAZy Family: GH71
• CAZyme Description: glycoside hydrolase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		39602.97	5.0100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907493:564891-566096(-)

Full Sequence      

MKRLMHLLAVVLFSYIVNALPYDNHADKRDLATPSDTEAANVIVWVDQDGDVLASNAADS
NQAPTATGSNSPTNLPPLLPVLDDDVPFQLSPALPVSEPSNPPQTGNDRRFGISYSPYND
DGTCKTQDQVNQDLDKLTQYAFVRIYGIDCDQTKKVTTAARQRNLKVFAGVFDLQNFPAS
LDYITGAAAGDWSVFHTITIGNELVNKGQNSVGDVVNAVNTARKRLRAAGYRGSVVTVDT
FSVMLQHPELCVVSDYCAANCHAFFDANNTPDQAGQYVKNQAAQISKAAHNKKTLITESG
WPHAGQANGEAIPSPENQQKALTSLKQAFTGSDQLVLFTAFDDQWKQDSSGTYGAEKYWG
IEKH

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_392578-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	112	361	2.1e-24	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.84e-66	95	361	30	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.003	281	361	216	296	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47997.1|GH17	4.47e-195	1	364	1	363
BCS13276.1|GH17	7.02e-192	1	361	1	360
BCS01560.1|GH17	7.02e-192	1	361	1	360
ACQ00076.1|GH17	1.46e-134	42	362	23	362
BCS24296.1|GH17	3.19e-131	7	361	6	362

PDB Hits     

ASPCADRAFT_392578-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	4.30e-69	97	361	115	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	4.57e-68	112	361	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	9.55e-63	112	361	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q2US39|BTGE_ASPOR	4.15e-42	109	360	345	596	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	4.15e-42	109	360	345	596	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999796	CS pos: 19-20. Pr: 0.9839

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_392578-t33_1-p1.