CAZyme Information: ASPCADRAFT_212173-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_212173-t33_1-p1
• CAZy Family: GH51
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	KV907572|CGC1	61246.99	8.5453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907572:3559-5242(-)

Full Sequence      

MAHPPRKILLVVTTGGFTHAAPVLEIGKVLAGRGHTIEFATLNGQEHWINDYPFISQLHL
LGDGPTEKQYDEHYLRMRTWDMSVGLAGAMPSKYMFDSFWPITYRGLKAIMEDPAHRPDF
IVADFFVDAVKDMKIQYGVQIAIVMPTMPVLMLPCSYIPGQPGFQLDMTLTSEHASMWLR
IKNELVVVKGLPEIIRLFRWTKRMRRENGVNYDLPSQKKPDYIVFVNSFFGLEIPRDLPP
LAAAVGPILGDEYPALDADCEQFLSTHKRVLYMALGTHIILSNADAAKIMTALFRLLETA
LLDGVIWAVGKSGRQDLDLNHTFDTFSGPVTFDDILSGRHPGFLCPFFAPQRAILDHEAV
QIYFTHGGGSSANEGLFHGTRMLTMGIFSDQIANTARLVHGGVAEPLNKFNFTSEEIYEK
AKRVLEDKEGKYARNSLRFQRISRVAARRKYYAADLIEEVMYDNELRFKDNKELRPMHLQ
TADVRMPAYKARNWDLMAVGLVALVGGLGGVGILGRMLWRNRLLAKRAWEELAYRAGGLL
RR

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_212173-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	84	433	2.3e-22	0.7774869109947644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.35e-38	10	459	4	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	6.51e-12	336	476	312	451	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	4.38e-11	7	461	3	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215465	PLN02863	6.88e-09	244	399	245	401	UDP-glucoronosyl/UDP-glucosyl transferase family protein
178572	PLN02992	1.37e-08	240	438	239	438	coniferyl-alcohol glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59607.1|GT1	6.34e-262	3	522	7	530
QLI65751.1|GT1	2.83e-249	1	524	1	525
BCR88254.1|GT1	2.40e-237	3	525	6	533
QQK45460.1|GT1	6.04e-236	3	522	7	530
CAK46937.1|GT1	2.04e-232	4	522	9	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NLM_A	1.39e-11	2	447	12	454	Chain A, indoxyl UDP-glucosyltransferase [Persicaria tinctoria],5NLM_B Chain B, indoxyl UDP-glucosyltransferase [Persicaria tinctoria]
6SU6_A	4.49e-11	9	447	38	475	Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU6_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU7_A Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_C Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_D Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria]
7ERX_A	2.50e-07	268	399	273	389	Chain A, Glycosyltransferase [Oryza sativa Japonica Group],7ERY_A Chain A, Glycosyltransferase [Oryza sativa Japonica Group],7ES0_A Chain A, Glycosyltransferase [Oryza sativa Japonica Group],7ES1_A Chain A, Glycosyltransferase [Oryza sativa Japonica Group]
7ES2_A	2.50e-07	268	399	273	389	Chain A, Glycosyltransferase [Oryza sativa Japonica Group]
6LZX_A	1.85e-06	222	394	237	418	Structure of Phytolacca americana UGT3 with 15-crown-5 [Phytolacca americana],6LZX_B Structure of Phytolacca americana UGT3 with 15-crown-5 [Phytolacca americana],6LZY_A Structure of Phytolacca americana UGT3 with 18-crown-6 [Phytolacca americana],6LZY_B Structure of Phytolacca americana UGT3 with 18-crown-6 [Phytolacca americana],7VEJ_A Chain A, Glycosyltransferase [Phytolacca americana],7VEJ_B Chain B, Glycosyltransferase [Phytolacca americana],7VEK_A Chain A, Glycosyltransferase [Phytolacca americana],7VEK_B Chain B, Glycosyltransferase [Phytolacca americana],7VEL_A Chain A, Glycosyltransferase [Phytolacca americana],7VEL_B Chain B, Glycosyltransferase [Phytolacca americana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q28611|UD16_RABIT	4.02e-09	154	438	188	441	UDP-glucuronosyltransferase 1-6 OS=Oryctolagus cuniculus OX=9986 GN=UGT1 PE=1 SV=1
sp|A0A291PQF1|UGT5_DACCO	5.28e-09	334	505	329	489	UDP-glycosyltransferase UGT5 OS=Dactylopius coccus OX=765876 GN=UGT5 PE=1 SV=1
sp|P06133|UD2B4_HUMAN	1.62e-08	151	442	187	448	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|B3VI56|U91D2_STERE	3.41e-08	232	458	235	458	UDP-glycosyltransferase 91D2 OS=Stevia rebaudiana OX=55670 GN=UGT91D2 PE=1 SV=1
sp|Q6UWM9|UD2A3_HUMAN	3.73e-08	350	442	356	446	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999694	0.000352

TMHMM  Annotations     

Start	End
496	518